KEGG   Yersinia aldovae: AT01_3802Help
Entry
AT01_3802         CDS       T03605                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
yal  Yersinia aldovae
Pathway
yal00020  Citrate cycle (TCA cycle)
yal00190  Oxidative phosphorylation
yal00650  Butanoate metabolism
yal01100  Metabolic pathways
yal01110  Biosynthesis of secondary metabolites
yal01120  Microbial metabolism in diverse environments
yal01130  Biosynthesis of antibiotics
yal01200  Carbon metabolism
Module
yal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
yal_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:yal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT01_3802 (sdhB)
   00650 Butanoate metabolism
    AT01_3802 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AT01_3802 (sdhB)
Enzymes [BR:yal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AT01_3802 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AT01_3802 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AJJ63444
LinkDB All DBs
Position
4165425..4166141
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDNAPYMQDYTLDAEEGRDMMLLDALILLKETDPTLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALQKGNKKIVIRPLPGLPVVRDLVVDMGQFYTQYEKIKPY
LLNDGKNPPAREHLQSPEQREKLDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYR
FLIDSRDTETPARLDDLDDAFSVFRCHSIMNCVSVCPKGLNPTKAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgagttctcaatttatcgctataacccggacgtcgataacgccccgtatatg
caggattacacgttagacgcggaagaaggccgggatatgatgttgctggatgctctcatc
ttgctaaaagaaacagatccgacactgtcgtttcgtcgctcatgccgtgaaggggtgtgt
ggctccgacggtctgaatatgaatggcaaaaatgggctggcgtgtattacccccatctcg
gctttgcaaaagggcaataagaagattgtgattcgccccttgccagggctgccagtggtg
cgggatttagtggtcgatatggggcagttttatactcagtacgagaaaattaaaccttac
ctgttgaacgacggcaaaaatccgccagcacgcgagcatttacagtctccggaacagcgc
gaaaaactcgatggtctgtatgaatgcatcttgtgcgcctgttgctcaacgtcttgtccg
tccttctggtggaatccggataaattcgttggcccggcagggttactggctgcctaccgt
ttcctgattgatagccgtgataccgaaacaccagcacgattagatgatctggacgacgct
tttagtgttttccgctgccatagcatcatgaattgtgtcagtgtttgtcctaaaggcctt
aacccgaccaaagcgattggccacatcaagtctatgttgttacaacgcagcgcatga

DBGET integrated database retrieval system