KEGG   Yersinia aldovae: AT01_3843Help
Entry
AT01_3843         CDS       T03605                                 

Definition
(GenBank) lactonase, 7-bladed beta-propeller family protein
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
yal  Yersinia aldovae
Pathway
yal00030  Pentose phosphate pathway
yal01100  Metabolic pathways
yal01110  Biosynthesis of secondary metabolites
yal01120  Microbial metabolism in diverse environments
yal01130  Biosynthesis of antibiotics
yal01200  Carbon metabolism
Module
yal_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
yal_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:yal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AT01_3843
Enzymes [BR:yal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     AT01_3843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase SGL
Motif
Other DBs
NCBI-ProteinID: AJJ64999
LinkDB All DBs
Position
4207385..4208386
Genome map
AA seq 333 aa AA seqDB search
MKQVVYVASPDSQQIHVWQLDSAGELTLLQTVDAPGQVQPMTISPNQRHLYVGVRPDFGI
VSYNIAGDGTLTAAGMAPLPGSPTHIGTDLQGRFLFCASYSFNCVSISPINEQGVVQAPI
QQLDNLPAPHSANIDPTNQILLVPCLKEDKVRLFDLSIDGKLTPHAQADIAVAAGAGPRH
MAFHPNHQIAYCVNELNSSVDVYQISDNGQEYKLIQTLDAMPTDFSGTRWAADIHITPNG
RHLYSSDRTASLLSIFSVSDDGRTISPAGHHLTEAQPRGFNIDHSGNFLIASGQKSDHIE
VCRIDNNSGELTTLKRYAVGKGPMWVSIGEPRT
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagtggtttacgtggcaagcccagacagtcagcagattcatgtctggcaatta
gattcagccggtgaattaactttattgcaaaccgtggatgcgcccggccaggtgcaaccg
atgacaatcagcccgaaccagcgtcatttgtatgtcggggtgcgtcctgattttggtatc
gtcagttataatattgcaggtgacggcaccttgacggctgcgggaatggcaccacttccc
ggcagcccgacccatattggcactgatttgcaaggccgcttcctgttctgtgcctcttac
agtttcaattgcgtgagcatcagcccaattaatgaacagggtgtggtgcaggcgcctatt
cagcaattagataatttgcccgcgccgcattcggcaaatattgacccgaccaatcaaatc
ttactggtgccttgcctgaaagaagataaagtgcggttatttgatttaagtattgatggc
aagctgacgcctcatgcgcaggccgatatcgcggtggccgccggtgcagggccacgtcat
atggctttccatccgaatcatcaaatcgcttattgcgtcaatgaactcaatagctcggta
gatgtgtatcagataagcgataacggccaagaatataagctaatccagacgttggatgcg
atgccaactgatttcagcggtacgcgctgggcggcagacattcatatcacgccaaatggt
cgccatttgtatagcagtgaccgcaccgccagcctgctgagtattttcagtgtctccgac
gatgggcgcaccatttcaccagcagggcatcatttgaccgaagcacaaccgcgtggcttt
aatattgaccacagcggtaacttcctgattgcgtccgggcaaaaatcagatcatatcgaa
gtgtgccgtattgataacaacagcggtgagctaaccaccctgaagcgctatgcggtaggg
aaagggccaatgtgggtcagtattggtgagccaagaacttaa

DBGET integrated database retrieval system