KEGG   Yersinia aldovae: AT01_523Help
Entry
AT01_523          CDS       T03605                                 

Definition
(GenBank) thymidine kinase family protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
yal  Yersinia aldovae
Pathway
yal00240  Pyrimidine metabolism
yal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yal00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AT01_523
Enzymes [BR:yal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AT01_523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AJJ62792
LinkDB All DBs
Position
complement(562344..562946)
Genome map
AA seq 200 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDNRFGVGTVSSRIGLSSQAL
LYNSATSLFAIITTEHQAKPIHCILLDECQFLTKEQIQELCQVVDDLDIPVLCYGLRTDF
LGELFPGSKYLLAWADKLVELKTICHCGRKANMVLRLDAQGKAVHDGEQVVIGGNESYVS
VCRRHYKEAIKAACQPDSCE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttttattactctgcaatgaatgcaggaaagtccacagcgctgtta
cagtcttcttataactatcaggagcgcggtatgcgcaccttggtatttaccgctgagata
gataaccgctttggcgtcgggaccgtaagttcacgcattggcctctcttcacaagcactc
ctgtataatagtgcgacatcactgttcgcgataatcacgacagaacatcaggcaaagcct
atacattgtattctgcttgatgaatgccagtttctgaccaaagaacagattcaggaactg
tgtcaggtggttgatgatctcgatatcccggtattgtgctatggactacgaactgatttt
cttggcgagctttttcctggcagcaaatatttgctggcatgggcggataaactggtggag
ctaaaaacgatttgtcattgtggtcgcaaagctaatatggtgctgcgtttagatgcgcag
ggtaaagcagtacatgatggcgagcaggtggttattggtggcaacgaaagttatgtttcc
gtttgtcgccgccattataaagaagcgattaaagccgcttgccaaccagattcatgtgag
tag

DBGET integrated database retrieval system