KEGG   Yangia sp. CCB-MM3: AYJ57_01310Help
Entry
AYJ57_01310       CDS       T04443                                 

Definition
(GenBank) glutamine amidotransferase
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
yan  Yangia sp. CCB-MM3
Pathway
yan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
yan00405  Phenazine biosynthesis
yan01100  Metabolic pathways
yan01110  Biosynthesis of secondary metabolites
yan01130  Biosynthesis of antibiotics
yan01230  Biosynthesis of amino acids
yan02024  Quorum sensing
Module
yan_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:yan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AYJ57_01310
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    AYJ57_01310
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AYJ57_01310
Enzymes [BR:yan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     AYJ57_01310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ANT59112
UniProt: A0A1B1PKL0
LinkDB All DBs
Position
1:272242..272823
Genome map
AA seq 193 aa AA seqDB search
MLLLIDNYDSFTWNLVHYVGELGVEAKVIRNDQIDVQEAMALKPEGILLSPGPCTPTEAG
ICLSLTHAAAETGTPLFGVCLGHQTIGQAFGGTVKRHDEIVHGKIAQMHHDDTGVFAGLP
SPFEATRYHSLVVARDDLPEELVVNAWLEDGTIMGLRHRELPIHGVQFHPESIASQHGHA
LIENFLKTMKVPA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttctcatcgacaattacgacagtttcacctggaacctcgtgcattacgtgggc
gagctgggcgtggaggccaaggtcatccgcaacgaccagatcgacgtgcaggaggcgatg
gcgctgaaacccgagggcatcctgctctcgcccggcccctgcacccccaccgaggcgggc
atctgcctgtcgctcacccacgccgccgccgagaccggcacgccgctctttggggtgtgc
cttgggcatcagaccatcggtcaggcgttcggcggcacggtcaagcgccacgacgagatc
gtccacggcaagatcgcgcagatgcaccatgatgacaccggcgtttttgccgggctgccc
tcgccgttcgaggcgacgcgctatcacagcctcgtcgtcgcgcgcgacgatctgcccgag
gagctggtggtcaacgcttggctcgaggatggcacgatcatggggctgcggcaccgcgaa
ctgccgatccacggcgtgcagttccaccccgagagcattgcctcgcagcacggccatgcc
ctcatcgagaatttcctgaagaccatgaaagtccctgcatga

DBGET integrated database retrieval system