KEGG   Yangia sp. CCB-MM3: AYJ57_04930Help
Entry
AYJ57_04930       CDS       T04443                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
yan  Yangia sp. CCB-MM3
Pathway
yan00061  Fatty acid biosynthesis
yan00780  Biotin metabolism
yan01100  Metabolic pathways
yan01130  Biosynthesis of antibiotics
yan01212  Fatty acid metabolism
Module
yan_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:yan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AYJ57_04930
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AYJ57_04930
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AYJ57_04930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yan01004]
    AYJ57_04930
Enzymes [BR:yan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AYJ57_04930
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AYJ57_04930
Lipid biosynthesis proteins [BR:yan01004]
 Fatty acid synthase
  Component type
   AYJ57_04930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ANT59772
UniProt: A0A1B1PML6
LinkDB All DBs
Position
1:1007021..1007812
Genome map
AA seq 263 aa AA seqDB search
MGELLKGKRGLIMGVANDRSIAWGIAKALHEAGAELAFTYQGEAFGKRLEPLAQSVGSDF
MVDVDVTDDASLDAAFEQLGARWPTIDFVVHAIAFSDKSELTGRFLNTSRSNFKNSMDIS
CYSFIEVARRAHPLMVENGGTLLTLTYDGSIKVVPNYNVMGVAKAALESATRYLANDLGP
EGIRVNAISPGPMKTLAGAAIGGARKTYKFTEQNTPLRSNATLEAVGGTAVYLVSDAGAC
TTGEILHVDGGFHILGMPQAENI
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcttctcaagggcaagcgcgggctgatcatgggggtggcgaacgaccgctcc
atcgcgtggggcatcgccaaggcgctgcacgaggcgggggcggagcttgccttcacctat
cagggcgaggctttcggcaagcggctggagccgctggcgcagagcgtcggctcggatttc
atggtcgatgtggacgtcaccgacgacgcctcgctcgacgccgccttcgaacagcttggc
gcgcgctggccgaccatcgacttcgtggtccacgccatcgcgttctcggacaaatccgag
ctgaccggccggttcctcaacaccagccgctcgaacttcaagaactcgatggacatctcc
tgctactcgttcatcgaagtggcgcgccgcgcgcatccgctgatggtcgagaacggcggc
acgctgctgacgctcacctacgacggctcgatcaaggtcgtgccgaattacaacgtcatg
ggcgtggccaaggcggcgctggaatcggcgacccgttatctggcgaacgacctcggcccc
gagggcatccgcgtgaacgcgatctcccccggcccgatgaagaccctcgcgggcgcggcc
atcggcggcgcgcgcaagacctacaagttcaccgagcagaacaccccgctgcgctccaac
gcgacgctcgaggcggtgggcggcacggcggtctatctggtctccgacgcgggcgcctgc
accacgggcgagatcctgcatgtggacggcggcttccatatcctcggcatgccgcaggcc
gagaacatctga

DBGET integrated database retrieval system