KEGG   Yangia sp. CCB-MM3: AYJ57_09910Help
Entry
AYJ57_09910       CDS       T04443                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
yan  Yangia sp. CCB-MM3
Pathway
yan00240  Pyrimidine metabolism
yan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AYJ57_09910
Enzymes [BR:yan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AYJ57_09910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14 AAA_19
Motif
Other DBs
NCBI-ProteinID: ANT60654
UniProt: A0A1B1PPY2
LinkDB All DBs
Position
1:complement(2035227..2035820)
Genome map
AA seq 197 aa AA seqDB search
MAKLHFHYSTMNAGKSTLLLQAAHNYRERGMEVFLLTAKLDTRAGQGRIGSRIGLGQEAE
TFAAEDDLFAMIAAAREATPLACIFIDEAQFLTEEQVWQLARVVDDLKLPVMAYGLRVDF
RGKLFPGSAALLALADTLREVRTICHCGRKATMVVRQDGDGNVLTDGAQVQIGGNESYVS
LCRKHWRDAMGDHAAQG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgcattttcactattcgaccatgaacgccggcaaatcgaccctgcttctg
caagcggcgcacaactatcgcgaacgcggcatggaggtcttccttctgaccgcaaagctc
gacacgcgcgccgggcagggccgcatcggctcgcgcatcgggctgggacaagaggccgag
accttcgccgccgaggacgatctttttgcgatgatcgccgccgcacgagaggcgacgccg
ctggcctgcatcttcatcgacgaggcgcagttcctcaccgaagagcaggtctggcaattg
gcgcgagtggtcgacgacctgaagctgccggtgatggcctatggcctgcgggtggatttc
cgcggcaagctgtttccgggctcggcggcgctgctggcgctggccgatacgctgcgcgag
gtgcgcaccatctgccattgcgggcgcaaggcgacgatggtggtgcggcaggatggtgac
ggcaatgtgctgaccgacggcgcgcaggtgcagatcggcggcaatgaatcctacgtctcg
ctgtgccgcaagcactggcgcgacgcgatgggcgaccacgccgcgcagggctga

DBGET integrated database retrieval system