KEGG   Yangia sp. CCB-MM3: AYJ57_11600Help
Entry
AYJ57_11600       CDS       T04443                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
yan  Yangia sp. CCB-MM3
Pathway
yan00473  D-Alanine metabolism
yan00550  Peptidoglycan biosynthesis
yan01100  Metabolic pathways
yan01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:yan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AYJ57_11600
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AYJ57_11600
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AYJ57_11600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:yan01011]
    AYJ57_11600
Enzymes [BR:yan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AYJ57_11600
Peptidoglycan biosynthesis and degradation proteins [BR:yan01011]
 Precursor biosynthesis
  Amino acid ligase
   AYJ57_11600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 B12-binding
Motif
Other DBs
NCBI-ProteinID: ANT60952
UniProt: A0A1B1PQZ3
LinkDB All DBs
Position
1:2394825..2395715
Genome map
AA seq 296 aa AA seqDB search
MAVLMGGPSAEREVSLSSGQECAAALRDEGFDVIEIDAGPDLAARLKDLSPDVVFNALHG
RWGEDGCVQGMLEWLRIPYTHSGVLSSALAMDKDRSKQVYRAAGLPVVESVLADKAEVCA
RHVMAPPYVVKPYNEGSSVGVYLVMDGANTPPQLSEEMPQTVMVETYAPGRELTTTVLGD
QALTVTDIITDGWYDYDAKYKAGGSRHEVPANVPQEIFDACLDYAVRAHKALGCRGLSRT
DFRWDESRGLDGLVLLETNTQPGMTPTSLAPEQAQASGMSFGALCRWMVEDASCDR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtattgatgggcggaccctcggctgaacgcgaggtgtcgctgagttccggtcag
gaatgcgccgccgctttgcgggacgagggatttgacgtgatcgagatcgacgcggggcct
gatctggccgcgcggctgaaggatctgtctcccgacgtcgtcttcaacgcacttcacggt
cgctggggcgaggatggatgcgtgcagggcatgctggagtggctccgcatcccctatacg
cactctggtgtgctgtcttccgcgctggcgatggacaaggaccgctccaagcaggtctat
cgcgccgccggtctgccggtggtcgaaagcgtgctggcggataaggccgaggtttgcgcc
cgtcacgtgatggcaccgccctatgtggtgaagccctacaacgagggcagctcggtcggc
gtctatctggtgatggacggggccaatacgccgccgcagctgtccgaagagatgccgcag
acggtgatggtcgagacctatgcgccgggccgcgagctgaccaccacggtgctgggcgat
caggcgctgaccgtcaccgacatcatcactgacggctggtacgactacgacgccaagtac
aaagcgggcggctcgcgccacgaggtgcccgccaacgtgccgcaggagatctttgatgcc
tgcctcgattatgcggtgcgcgcgcataaggcgcttggctgccgcggcctcagccgcacc
gatttccgctgggacgagagccgcggccttgatgggctggtgctgctcgagaccaacacc
cagccgggcatgacgcccacctcgctggcgcccgaacaggcgcaggcgtcgggcatgtcc
ttcggcgcgctctgccgctggatggtggaggacgcctcatgcgacaggtag

DBGET integrated database retrieval system