KEGG   Yangia sp. CCB-MM3: AYJ57_12760Help
Entry
AYJ57_12760       CDS       T04443                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
yan  Yangia sp. CCB-MM3
Pathway
yan00970  Aminoacyl-tRNA biosynthesis
yan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yan00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AYJ57_12760 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:yan03029]
    AYJ57_12760 (gatB)
Enzymes [BR:yan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AYJ57_12760 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AYJ57_12760 (gatB)
Mitochondrial biogenesis [BR:yan03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AYJ57_12760 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N Pox_I1
Motif
Other DBs
NCBI-ProteinID: ANT61161
UniProt: A0A1B1PRD2
LinkDB All DBs
Position
1:complement(2652717..2654231)
Genome map
AA seq 504 aa AA seqDB search
MLDLSFEPPKPKVIAGAKYDWELVIGMEIHAQISTEAKLFSGASTQFGAEPNSNVAFVDA
AMPGMLPVINEYCIEQAVRTGLGLKAEINLKSAFDRKNYFYPDLPQGYQISQLYHPLVGE
GEVIVDMEPGIARKVRIERIHVEQDAGKSIHDMDPSMSFVDLNRTGVALMEIVSRPDIRG
PEEAAAYVVKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTRC
EIKNMNSMRFIQQAIDYEAKRQIAILENGGSVDQETRLYDPDKGETRSMRSKEEAHDYRY
FPDPDLLPLEIEQGWVDDIAASLPELPDEKKARFVKDFGLSEYDAGVLTAEVVNSAYFEE
VVTACNDGKLAANWVINELFGRLKKEGHDITESPVSPAQLAGIIALIKKGDISGKIGKDV
FEILYTEGGDPAQIVEAKGLKQVTDTGAIETAVDEVIAANPAQVEKAKQNPKLAGWFVGQ
VMKSTGGKANPKAVNEIVAAKLGL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacctgagcttcgagccccccaaacccaaggtcattgccggcgccaaatacgat
tgggagctggtgatcgggatggagattcacgcccagatttccaccgaggcaaagctgttc
tccggcgcctccacccaattcggtgccgagccgaactcgaacgtggccttcgtggacgcg
gcgatgcccggcatgctgccggtgatcaacgagtattgcatcgagcaggccgtgcgcacc
gggctgggtctgaaggccgagatcaacctgaaatccgccttcgaccgcaagaactacttc
taccccgacctgccgcagggctatcagatttcgcagctctaccacccgctggtgggcgaa
ggcgaagtcatcgtcgacatggagccgggcatcgcccgcaaggtgcgcatcgagcgcatc
catgtcgagcaggacgcgggcaagtcgatccacgacatggacccgtcgatgtccttcgtc
gacctcaaccgcaccggcgtggcgctgatggagatcgtcagccgccccgacatccgcggc
cccgaggaagcggcggcctatgtggtgaagctgcgccagatcctgcgctacctcggcacc
tgcgacggcaacatgcaaaacggcaacctgcgcgctgacgtgaacgtctcggtctgccgt
cccggccagtacgagaagtatcaggagacgcaggacttcagccacctcggcacgcgctgc
gaaatcaagaacatgaactccatgcgctttatccagcaggccatcgactacgaggcgaag
cgccagatcgcgatcctcgaaaacggcggctcggtggatcaggagacccgtctttacgat
ccggacaagggcgagacccgttcgatgcgctcgaaggaagaggcgcatgactaccgctac
ttccccgaccccgacctgctgccgctcgagatcgagcagggctgggtggacgatatcgcc
gcctcgctgccggaactgcccgacgaaaagaaggctcgtttcgtcaaggacttcggcctg
tcggaatacgacgcgggcgtgctgaccgcggaagtggtgaactcggcctatttcgaagag
gtggtcaccgcctgcaacgacggcaagctggccgccaactgggtgatcaacgagctgttt
ggccgcctcaagaaagagggccatgacatcaccgagagcccggtctcgccggcgcagctt
gcggggatcatcgcgctgatcaaaaagggcgacatctcgggcaagatcggcaaggacgtc
ttcgagatcctctacaccgaaggcggcgacccggcgcagatcgtcgaggcaaagggcctc
aagcaggtcaccgacaccggcgcgatcgagaccgcggtggacgaggtgatcgcggccaac
ccggcgcaggtcgaaaaggccaagcagaaccccaagctcgcgggctggttcgttggtcag
gtgatgaaatccaccggcggcaaggccaaccccaaggcggtgaacgagatcgtcgccgcg
aagctgggcctctga

DBGET integrated database retrieval system