KEGG   Yangia sp. CCB-MM3: AYJ57_16105Help
Entry
AYJ57_16105       CDS       T04443                                 

Definition
(GenBank) polysaccharide deacetylase
Organism
yan  Yangia sp. CCB-MM3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OHCU_decarbox Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: ANT61970
UniProt: A0A1B1PTW1
LinkDB All DBs
Position
2:complement(487662..489098)
Genome map
AA seq 478 aa AA seqDB search
MTLLSPLPATRYPRDLTGYGETPPDARWPNGAKIAVQIVVNYEEGGENNVLHGDAASEAF
LSEIVGAAQWPGQRHWNMESIYEYGARAGFWRLHRLLKDIPVTVYGVATALARAPEQVAA
MKRAGWEIASHGLKWVEHKDMPEEEERAQIREAIRLHTLVTGAPPRGWYTGRCSMNTVRL
AAEEGDFAYIADSYADDLPYWSRVAGKDQLIVPYTLDANDMRFASPQGFNSGDQFESYLR
DSFDTLYEEGQEGAPKMLSIGLHCRLVGRPGRVAALKRVLAYMASHDGVWFATREQIADH
WAAQHPAKAGPRPSEMDRASFTEAFGGVFEHSPWIAEGAHALQLGPTHDSALGVHSVLAR
VFRDAPDEKRLAVLTAHPDLAGKLAQAKRLTAESTSEQAGAGLDALTDDERAAFTELNEA
YTAKFGFPFIIAVRDNDKASIMQAFRRRIENDRATEFAEACCQVERIAELRLIDKLGA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgttgagcccgctgcccgcgacccgctatccccgcgacctgaccggctatgga
gagaccccgcctgatgcccgctggccgaacggcgccaagatcgcggtgcagatcgtggtc
aactacgaggagggcggcgagaacaacgtcctgcacggtgatgcggcgtccgaggcgttc
ctttcagagatcgtcggtgccgcgcaatggcccggccagcgccattggaacatggagtcg
atctatgaatacggcgcccgcgccgggttctggcggctgcatcggctgctgaaggatatc
cccgtcaccgtctatggcgtcgccaccgcgcttgcccgcgcgcccgagcaggttgccgcg
atgaagcgcgccggttgggagatcgcttcgcatgggctcaaatgggtcgagcacaaggat
atgcccgaggaagaagagcgcgcgcagatccgtgaggcgatccgcctgcacacgctggtg
accggcgcgccgccgcgcggctggtacaccgggcgctgctctatgaacacggtccggctc
gccgccgaagagggcgatttcgcttatatcgccgacagctacgccgatgatctgccctat
tggagccgggtcgcgggcaaggatcagctgatcgtgccctatacgctggatgccaatgac
atgcggtttgcctcgccgcaggggttcaactctggcgaccagttcgaaagctacctgcgc
gacagtttcgacacgctctatgaggaagggcaggagggcgcgccgaagatgctgtcgatc
gggctgcactgccgtctggtcggtcgcccgggccgtgtcgcggcgctgaagcgggtgctg
gcgtatatggcctcgcacgacggggtctggttcgccacgcgcgagcagatcgccgatcat
tgggcggcgcagcatcctgcgaaggcgggcccgcgtccctccgagatggaccgggccagc
ttcaccgaggctttcggcggtgtcttcgagcacagcccgtggatcgccgagggcgcccat
gcgctgcagcttggcccgacgcatgacagcgcgctgggcgtgcattcggtgctggcgcgg
gtgttccgcgacgcccctgacgagaagcggctggcggtgctgaccgcgcaccccgacctt
gcgggaaaactggcgcaggccaagcgcctgacggcggagtcgacctcggagcaggcaggc
gccgggctcgacgcgctcaccgacgacgagcgcgctgccttcaccgagctcaatgaggct
tacaccgcgaaattcggctttcccttcatcatcgcggtgcgcgacaacgacaaggcgtcg
atcatgcaggccttccgccgccgcatcgagaacgaccgcgccaccgagttcgccgaggcc
tgctgtcaggtcgaacggatcgccgaactgcggctgatcgacaagctcggcgcatga

DBGET integrated database retrieval system