KEGG   Yangia sp. CCB-MM3: AYJ57_17550Help
Entry
AYJ57_17550       CDS       T04443                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
yan  Yangia sp. CCB-MM3
Brite
KEGG Orthology (KO) [BR:yan00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AYJ57_17550
Enzymes [BR:yan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     AYJ57_17550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Methyltransf_25 MTS Methyltransf_11 PrmA LmjF365940-deam 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ANT62229
UniProt: A0A1B1PUG8
LinkDB All DBs
Position
2:complement(825975..827018)
Genome map
AA seq 347 aa AA seqDB search
MRAIVIHAPKDLRVDEIASAPAPAAGEVRVAISHGGICGSDLHYYHHGGFGSVRVREPMA
LGHEVSGIVTEIGSGVTGLAEGDRVAVNPSRPCGACEYCLRGLANHCLDMRFNGSAMRFP
HEQGLFRAQVTVPAAQLVQLSPNADLALAAMSEPLAVCLHAVRLAGSLIGKRVVVSGCGP
IGCLTIAAARHAGAEEIIATDISATALSAAKQMGADHTIDLSQGSDALASLGTAKGQVDV
AFECSGAPPAVVAACTFLRPRGMLVTVGLGPETNLPMSAIVTRELQIVGSFRFAPEFATA
ARMIDAGRFDLRPLLTKVLPAEEAVSAFDLATDKTRAMKVQISFPAP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccatcgtcattcatgccccaaaagacctccgtgtcgacgagattgcctcggcc
cctgcccccgcagcgggcgaagtgcgcgtcgcaatcagccacggcgggatctgcggctcg
gatctgcactattaccatcacggtggtttcggctccgtgcgggtgcgcgagccgatggcg
ttggggcacgaggtgtcgggcatcgtcaccgagattggcagtggcgtgactgggttggcc
gagggcgaccgcgtggcggtgaacccctcgcggccctgcggcgcttgcgaatactgcctg
cgcgggctggccaaccattgcctcgacatgcgcttcaacggctcggccatgcggtttccg
cacgagcagggcctcttccgagcgcaggtcaccgtgccggcagcgcagttggtacagctg
tcgccgaacgcggatctggcgctggccgccatgtccgagcctttggctgtgtgtctgcac
gcagtacgtctcgccggcagcctgatcggcaagcgggtggttgtctccggctgcggcccg
atcggatgcctgaccatcgctgcggcccgccacgcgggcgccgaagagatcatcgccacc
gacatttcggccactgctctgagcgccgccaagcagatgggcgcagaccacacaattgac
ctatcgcagggctcggatgcacttgcgtccctgggcaccgccaagggtcaggtcgatgtc
gccttcgaatgttccggcgctccgcccgccgtggtcgctgcctgcaccttcctgcgcccc
cgcggaatgctggtcaccgttggcctcggccccgaaaccaacttgccaatgagtgcgatc
gtgacccgcgaattgcagatcgtcggcagcttccgcttcgcgccggagttcgcgacagcg
gcccggatgatcgacgccggtcgcttcgatctgcgaccgctgctcaccaaggtgctgcct
gctgaagaggcggttagcgccttcgatttagccactgacaaaacccgtgcaatgaaggtg
caaatcagcttcccagcgccttga

DBGET integrated database retrieval system