KEGG   Yersinia canariae: F0T03_10385
Entry
F0T03_10385       CDS       T06446                                 

Gene name
gstA
Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yca  Yersinia canariae
Pathway
yca00480  Glutathione metabolism
yca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    F0T03_10385 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yca02000]
    F0T03_10385 (gstA)
Enzymes [BR:yca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     F0T03_10385 (gstA)
Transporters [BR:yca02000]
 Other transporters
  Pores ion channels [TC:1]
   F0T03_10385 (gstA)
SSDB
Motif
Pfam: GST_C GST_N GST_N_2 GST_C_3 GST_N_3 GST_C_2 GST_N_5 Jiv90
Other DBs
NCBI-ProteinID: QHB32538
LinkDB
Position
complement(2210499..2211107)
AA seq 202 aa
MKLFYKPGACSLSPHIVLRESGLDFSIESVDLATKKTETGEDYLSINPKGQVPALLLDDG
SLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFVATELHKGFSPLFNPKTPDE
YKAIACERLDKQFSYVDSELAKHDYLLGSKFSVADAYLFTVTRWANALKLEIKQRSHLDK
FMARVAERPAVKAALAAEDAKK
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaattgttctataaacccggtgcctgctctttatccccacatattgtattacgtgaa
tcgggattagacttcagtattgaaagcgtcgatctggcgactaaaaaaactgaaacgggt
gaagactatttaagcatcaatcccaaaggacaagtccctgcgctgttgctcgatgacggt
agcctgctcactgaaggggttgctatcgtgcaatatctggcagataaagtgccggatcgc
catcttattgccccatcaggcaccctttcgcgctatcacgctattgagtggctaaacttc
gtggcgactgaattgcataaaggtttcagtccactgtttaaccctaaaacacccgatgaa
tataaagccattgcctgcgagcgcctggataagcaatttagctacgtcgatagcgaatta
gcaaagcatgattatctgctaggctcaaaattcagtgtggctgatgcctatttatttacc
gtgacccgctgggccaatgcactgaagcttgaaattaaacaacgtagccatttagataaa
tttatggcgcgtgtggctgaacgcccggcagtaaaagcagccctcgcggctgaagatgca
aagaaatga

DBGET integrated database retrieval system