KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_00931Help
Entry
YE5303_00931      CDS       T03739                                 

Definition
(GenBank) Putative glutathione S transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Pathway
yee00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:yee00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YE5303_00931
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yee02000]
    YE5303_00931
Enzymes [BR:yee01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     YE5303_00931
Transporters [BR:yee02000]
 Other Transporters
  Pores ion channels [TC:1]
   YE5303_00931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_N_4 GST_C_2
Motif
Other DBs
NCBI-ProteinID: CCQ38803
LinkDB All DBs
Position
460031..460702
Genome map
AA seq 223 aa AA seqDB search
MVIVHHLNNSRSQRILWMLEELQVPYELKRYQRDPGSLLAPPELKKIHPLGKSPVITDGD
LTLAESGAIIEYLQETYDAQGLFKPTGHYDRQQFRYWMHYAEGSLMPLLVMKLIFSRFGG
PPVPWIIRPVAKALGDGVQKNYLNKQIATHRDYLEQHLEKNQWFAGSDFSAADIQMSFPI
EAINMRGGLAGFPKLQDFLVRIHQRPAYQQAIEKGGAFKLENG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgttcaccatctgaataattcacgttcgcagcgtatcctgtggatgttggaa
gagttgcaagtcccctatgaattaaagcgttatcaacgcgatcctggtagcttgctggca
ccaccggagttgaaaaaaatccatcccctggggaaatcaccggtgattactgatggcgac
ctgacactggcggaatcgggtgccatcatcgagtatttgcaggaaacctatgatgcgcag
ggcttgtttaagcccaccggtcattatgatcgtcagcaatttcgttactggatgcattac
gcagaaggctccttgatgccattgctggtgatgaaacttatctttagccgcttcggcggg
ccgcctgtgccgtggattattcgtccggtcgccaaagctttgggtgatggggtgcagaaa
aattatctgaataagcaaattgccactcatcgcgattatctggaacagcatttagaaaag
aatcaatggtttgctggcagcgattttagcgcggcagatattcagatgagctttcctatt
gaggcaataaatatgcgcggtggtcttgcggggttcccgaaactgcaagatttcttagtg
cgcattcatcagcgcccagcttaccaacaggcgattgaaaagggcggcgcattcaaatta
gaaaacggataa

DBGET integrated database retrieval system