KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_15091Help
Entry
YE5303_15091      CDS       T03739                                 

Gene name
icdA
Definition
(GenBank) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Pathway
yee00020  Citrate cycle (TCA cycle)
yee00480  Glutathione metabolism
yee01100  Metabolic pathways
yee01110  Biosynthesis of secondary metabolites
yee01120  Microbial metabolism in diverse environments
yee01130  Biosynthesis of antibiotics
yee01200  Carbon metabolism
yee01210  2-Oxocarboxylic acid metabolism
yee01230  Biosynthesis of amino acids
Module
yee_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yee_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:yee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YE5303_15091 (icdA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YE5303_15091 (icdA)
Enzymes [BR:yee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     YE5303_15091 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: CCQ40214
LinkDB All DBs
Position
2043674..2044927
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYNG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIREYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKDIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLMEGAKLLKCSEFGDAIIKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaagaaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgatcattccatttattgaaggtgacggcattggcgtt
gatgtgaccccagccatgatcaacgtggtggatgctgcggttaagaaggcctataacggt
gagcgtaaaatctcctggatggaaatttacaccggtgagaaatcaacccatgtttatggc
aaagatgtttggttgccagaagaaacattggacttgattcgtgagtaccgcgttgcaatt
aaaggcccattgaccactccagtgggtggcggtattcgttctctgaacgttgctttgcgc
caacaactcgacttgtatgtgtgcctacgcccagtgcgttattacgaaggtaccccaagc
ccggtaaaacaccctgagttaaccaatatggtgattttccgcgaaaacgcagaagacatc
tatgcgggtatcgaatggaaagccggctcaccagaagctgaaaaagtgattaagttcctg
cgtgaagagatgggcgtgaagaaaatccgcttccctgaacaatgtggtattggtgtaaaa
ccctgttcagaagaagggactaagcgtttggttcgtgctgcaattgagtatgccattacc
aacgatcgtgaatcagtcaccctggttcataaaggcaacattatgaaattcaccgaaggc
gcatttaaagactggggttaccagttagcgcgtgaggaatttggtggtgagctgatcgat
ggcggcccttgggttaaaatcaagaatccaaacaacggtaaggacatcattgttaaagat
gtgattgccgatgctttcctgcaacagatcctgctgcgtccggctgaatatgatgttatc
gcgtgtatgaacttgaatggggattacatttctgatgcattggctgctcaagttggcggt
atcggtattgccccaggtgcaaacattggtgatgagtgcgcattgtttgaagcgactcat
ggtaccgcacctaaatatgcgggtcaggataaagtgaacccaggttctattattctgtct
gcagaaatgatgctgcgtcacatgggctggttcgaagccgcagacctgattatcaaaggc
accgaaggcgcaattcaagccaagacggtcacttatgatttcgaacgtctgatggaaggc
gctaagttactgaaatgttcagagtttggcgacgccattattaagcatatgtaa

DBGET integrated database retrieval system