KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_25881Help
Entry
YE5303_25881      CDS       T03739                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase [cu-zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Brite
Enzymes [BR:yee01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YE5303_25881 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CCQ41901
LinkDB All DBs
Position
complement(3906187..3906711)
Genome map
AA seq 174 aa AA seqDB search
MKLKYLLLPAIFLTGSALAADITVTMNEALPEGNGKALGTVTVSETPYGLLFTPNLTGLV
AGIHGFHLHENPSCTPGQKDGKAVPALTAGGHFDPQKTAAHLGPYNDKGHLGDLPGLVVN
ADGTATYQVLAPRLKSLSELKQHALMIHAGGDNYADHPMPLGGGGARMACGVIE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaatacctacttttacccgcgatctttttgactggtagcgcgctggctgcg
gatattactgtgaccatgaatgaagcgctaccggaaggcaatggtaaagctttgggtacc
gtgacagtaagcgaaacaccttatggtttattgttcacaccgaacctgactgggctggta
gcgggtattcatggtttccatctgcatgaaaatccaagttgtacaccggggcagaaagac
ggtaaagccgtgcccgcacttactgctggcggacattttgacccacaaaaaactgctgct
catctcgggccgtacaatgataaagggcatttaggcgacctacctggactggtggtgaat
gccgatgggactgccacttatcaggtattggctccacggctgaaatcactctctgaactg
aagcagcatgctttgatgatccatgctggtggggataattatgccgaccatccaatgcct
ctgggcggtggcggtgcacgaatggcttgtggagtgattgagtaa

DBGET integrated database retrieval system