KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_29121Help
Entry
YE5303_29121      CDS       T03739                                 

Gene name
dacB
Definition
(GenBank) penicillin-binding protein 4 precursor
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Pathway
yee00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:yee00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YE5303_29121 (dacB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:yee01002]
    YE5303_29121 (dacB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:yee01011]
    YE5303_29121 (dacB)
Enzymes [BR:yee01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     YE5303_29121 (dacB)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     YE5303_29121 (dacB)
Peptidases [BR:yee01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   YE5303_29121 (dacB)
Peptidoglycan biosynthesis and degradation proteins [BR:yee01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   YE5303_29121 (dacB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: CCQ42223
LinkDB All DBs
Position
4317872..4319320
Genome map
AA seq 482 aa AA seqDB search
MHFSRIVSGLACAIAINISISNANAAQVENYTQYLPDGANLALVVQKIGATTPAIDYHAQ
QMALPASTQKVLTALAALLQLGPDFRFNTTLESHGTISDGILRGNLIARFDGDPTLTRQQ
LRNMVATLRKSGVKQIAGDLIIDTSVFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFS
VSLYSAPNPGDMAFIRVASYYPVQMFSEVRTLAKGSPDAQYCELDVVPGELNRFTLTGCL
TQRSEPLPLAFAVQNGASYAGAILKDELKKADIQIDGSLRRQTTPNAAGTVLAQAQSAPL
HDLLKIMLKKSDNMIADTVFRTIGHQRFGVPGTWRAGADAVRQVLRQKAGVDLGNSIVVD
GSGLSRHNLISPATMMQALQYIAQHDQELNFISMLPLSGYDGTLRYRGGLHEAGVDGKVS
AKTGALQGVYNLAGFITTASGQRMAFVQFLSGYAVPPEDQKNRRAPLVRFESRLYKDIYQ
NN
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcatttttcacgaattgtcagtggattggcctgtgctattgcgatcaatatcagcata
tctaatgccaatgcggctcaagttgagaattacacacaatatctgcctgatggggcaaat
cttgcgttagtcgtacaaaaaatcggggccacaaccccagcaatagactatcacgctcag
cagatggcattgcctgccagtacgcaaaaagtcctgacagcgctggcggcattattgcag
cttgggccagattttcgcttcaataccacattggaaagccacggcacgattagtgatggg
attttacgtggcaatttaatagcgcgttttgatggcgaccccactttaacacgtcagcaa
ttgcgtaatatggtggcgacattaagaaaatcgggcgtaaaacaaatcgctggtgatttg
attattgatacgtcggtgtttgccagccatgacaaagctccaggttggccgtggaacgat
atgacacagtgctttagtgcgccgcctgcggccgcgattgtcgatcgtaactgtttttct
gtctctctttatagcgcaccgaatccaggtgacatggcatttatccgagtcgcatcttat
tacccggtgcagatgtttagtgaagttcgcaccttagccaaaggttcgcctgatgcgcaa
tattgcgaattagatgtggtgcctggtgaattaaaccgattcaccctgaccggctgcctg
acacagcgcagtgaaccgctacccttggcctttgcagtacaaaatggggccagctatgcc
ggtgctattttgaaagatgaattaaaaaaagctgacatccaaattgatggcagtttacgc
cgccagacgacccccaatgccgctggaaccgtattagctcaagctcaatcagcgccgtta
catgacttgctgaaaatcatgttgaaaaagtctgacaacatgattgctgacaccgtattt
agaaccattggtcatcagcgttttggcgtgccgggaacatggcgcgccggtgctgatgcg
gtacgccaggtgttgcgacaaaaagcaggtgtggatctggggaacagtattgtcgtggat
ggatcgggcttatcacgccataaccttatttcaccggcaaccatgatgcaggccttacag
tatatagctcagcatgatcaagaacttaactttatctcaatgctgccattatcaggctac
gacggcacattacgctatcgtggtgggttgcacgaagcgggtgttgacggcaaagtttca
gctaaaacaggcgcattacaaggcgtctacaatctggccggatttattactaccgccagt
gggcaacgcatggcttttgtgcaattcttgtcaggctacgctgtgccacctgaagatcaa
aaaaatcgccgcgcgccattggtgcgtttcgaaagccgactgtataaagacatttatcag
aacaactaa

DBGET integrated database retrieval system