KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_31161
Entry
YE5303_31161      CDS       T03739                                 

Definition
(GenBank) putative exported protein
  KO
K11906  type VI secretion system protein VasD
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Pathway
yee03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yee00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YE5303_31161
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yee02044]
    YE5303_31161
Secretion system [BR:yee02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YE5303_31161
SSDB
Motif
Pfam: T6SS-SciN DUF3323 Phage_TAC_8
Other DBs
NCBI-ProteinID: CCQ41163
LinkDB
Position
complement(3070210..3070761)
AA seq 183 aa
MIRLSMKKDIRWFNRITQYFFVALVTLLVMACSSKPQPEPVDKLAVELTTAKNINPNDKG
VANPLRITVYTLKNTDEFKSSDFFTITEEGTPSLKEQMEKVFDGIMLPNETKTIELTLNS
GVTAIGVVAAYREIEQAEWNAVFSPLPKKRVQPWYKKWWSGKQNDPVVKVRVERLSISIK
EMD
NT seq 552 nt   +upstreamnt  +downstreamnt
ttgattaggttgagtatgaaaaaagatatccgttggtttaatcggattacacaatacttt
ttcgtggcattggtcacgctattggtcatggcatgtagctcgaaacctcaacctgaaccg
gttgataaattggctgtcgagctgactacggcaaaaaatatcaatccaaatgacaaaggt
gtcgctaatccgttaaggatcaccgtttataccctgaagaatacggatgaatttaagtcg
agtgatttcttcactattaccgaagagggcacaccatctctgaaagagcagatggagaaa
gtgtttgacggaatcatgctgcctaatgagacaaaaacaatagaactgacgctaaacagt
ggggtcactgccatcggcgttgtagctgcttaccgtgaaattgagcaggcggagtggaac
gcggtttttagcccgttacccaagaaacgcgtgcagccctggtataaaaaatggtggtca
gggaaacaaaacgatccggtagtcaaggtgcgcgttgagcgtctgtcaatatcaatcaaa
gaaatggactaa

DBGET integrated database retrieval system