KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_38391Help
Entry
YE5303_38391      CDS       T03739                                 

Gene name
glyD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Pathway
yee00564  Glycerophospholipid metabolism
yee01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yee00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YE5303_38391 (glyD)
Enzymes [BR:yee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     YE5303_38391 (glyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: CCQ42547
LinkDB All DBs
Position
4654154..4655668
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWREQG
LWMVEAVDANTGKTFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDEYSIIGTTDVEYHGDPKDVKIDDQEIDYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEGGKAPLLSVFGGKLTTYRK
LAEHALEKLSGYYTNVGPAWTKTGSLPGGDIGGNRDNYTVQLRHRYNWLPEGLARRYTRT
YGSHSELILADATSIESLGEHFGHGLYEAELRYLVEKEWVVELDDAIWRRTKLGMMLDEA
QKQRISQWLAEAQAEKQQTLSLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggcattaatggtgccggtatcgctgcg
gacgctgcagggcgtggcctgtccgttctgctgctggaagcacaagatttggcctgtgct
acatcttctgccagctccaaactgatccacggtggcttacgttacctggaacactatgaa
ttccggttggtcagtgaagcattggccgaacgtgaggttttgctgaaactggctcctcat
atcgctttcccaatgcgctttcgcctgccccatcagccccatctgcgcccggcgtggatg
attcgtaccggcttattcttgtacgatcatttgggcaaacgtaccagcttgccagccagt
aaagggctacgctttggacccgaatcagtattaaagcccgagttagtgcgcggtttcgaa
tattctgactgctgggtagatgatgcccgtctggtcgtgctgaatgctcaggaagtggtc
gaacgtggcggcgaagtacgtactcgcaccaaagtgactcgcgcctggcgtgaacaaggc
ctatggatggtggaagcggtcgatgccaacaccggcaaaacctttacctggcgcgctaaa
gggttagtcaatgctaccggcccgtgggttaaacagttcttcgatgatggtctgaaactg
aaatcaccttatggcatccgcctgatcaaaggtagccatattgtggtgccacgggttcat
aaccagccacaagcctatattctgcaaaacgaagaccatcggattgtcttcgtcattcct
tggttggatgaatattccatcatcggtaccacagacgtcgaataccacggcgatccgaaa
gatgtgaagatcgacgaccaggaaattgattacctgctgaaggtctataacgaccacttt
aaaaagcaactgggccgcgatgatatcgtctggacttactctggcgttcgtccgctgtgt
gatgatgaatcagattcaccgcaagcggttacccgcgattacacactggatgtcgccgat
gaaggcggcaaagcaccgctgctgtcagtatttggtggcaaactgaccacctaccgcaaa
ttggcagaacatgcgctggaaaaactgtccggctactataccaatgtcggcccggcatgg
acaaaaaccggctcgttaccgggcggggatattggcggcaaccgtgataactacacggta
caactgcgccatcgctataactggctacctgaagggttggcgcgccgctatacccgtacc
tatggcagtcatagcgagctgattttggctgatgccaccagcatagaaagcttgggcgaa
cacttcggccacggtctgtatgaagcagaattgcgctatctagttgaaaaagagtgggtt
gttgaactcgatgatgccatctggcgtcgcaccaagttaggcatgatgctagacgaggca
caaaaacaacggatttctcagtggctggcagaagcgcaggctgagaaacaacagactctt
tccttggtctcctga

DBGET integrated database retrieval system