KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_39921Help
Entry
YE5303_39921      CDS       T03739                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Brite
Enzymes [BR:yee01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YE5303_39921 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HTH_54
Motif
Other DBs
NCBI-ProteinID: CCQ42700
LinkDB All DBs
Position
4856104..4856727
Genome map
AA seq 207 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLESFPELAKFSVEDLIKD
LDKVPAEKRTFMRNNAGGHANHSLFWKGLKLGTTLTGDLKAAIERDFGSVDSFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGFPIVGLDVWEHAYYLKFQ
NRRPDYIKAFWNVVNWDEAAARFAQAK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagttactcactgccatccctgccttatgcttatgacgccctggaaccacacttcgat
aagcagacgatggaaatccatcacaccaaacaccaccaaacctatgttaacaatgcaaac
acggtgttggagagcttccctgagctggctaaattcagtgttgaagatctgatcaaagat
ctggacaaagttccagctgaaaaacgcacctttatgcgtaataacgccggcggtcacgct
aaccacagcctgttctggaaaggcctgaaactgggcaccactctgaccggtgacctgaaa
gccgctatcgaacgcgacttcggcagcgttgacagcttcaaagaaaaatttgaacaagct
gcggcaacgcgtttcggttcaggctgggcctggctggtactgaaagacgacggcaaactg
gctgttgtttcgactgctaaccaagacagcccgctgatgggtgaagctgtttctggcgca
tcaggtttcccgattgtgggcctggatgtgtgggaacacgcttactacctgaaattccaa
aaccgccgcccagactacatcaaagcattctggaacgtggttaactgggacgaagcagcc
gcgcgtttcgctcaagctaagtaa

DBGET integrated database retrieval system