KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_42071Help
Entry
YE5303_42071      CDS       T03739                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex alpha subunit
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Pathway
yee00071  Fatty acid degradation
yee00280  Valine, leucine and isoleucine degradation
yee00281  Geraniol degradation
yee00310  Lysine degradation
yee00362  Benzoate degradation
yee00380  Tryptophan metabolism
yee00410  beta-Alanine metabolism
yee00640  Propanoate metabolism
yee00650  Butanoate metabolism
yee00903  Limonene and pinene degradation
yee00930  Caprolactam degradation
yee01100  Metabolic pathways
yee01110  Biosynthesis of secondary metabolites
yee01120  Microbial metabolism in diverse environments
yee01130  Biosynthesis of antibiotics
yee01200  Carbon metabolism
yee01212  Fatty acid metabolism
Module
yee_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:yee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    YE5303_42071 (fadB)
   00650 Butanoate metabolism
    YE5303_42071 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YE5303_42071 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YE5303_42071 (fadB)
   00310 Lysine degradation
    YE5303_42071 (fadB)
   00380 Tryptophan metabolism
    YE5303_42071 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YE5303_42071 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YE5303_42071 (fadB)
   00281 Geraniol degradation
    YE5303_42071 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YE5303_42071 (fadB)
   00930 Caprolactam degradation
    YE5303_42071 (fadB)
Enzymes [BR:yee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YE5303_42071 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YE5303_42071 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YE5303_42071 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     YE5303_42071 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CCQ38675
LinkDB All DBs
Position
complement(313152..315341)
Genome map
AA seq 729 aa AA seqDB search
MLYQSETLKLHWLENGIAELVFDAPGSVNKLDTQTVANLGEALVVLEKQSELKGLLLRSA
KAAFIVGADITEFLSLFNEPPEKLHQWLVFANDIFNRLEDLPVPTIAAINGYALGGGCEC
ILATDFRVASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDIIAKDALK
VGLVDAVVAPEKLVDAALSMLRQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGMV
MQVAGKHYPAPLTAVKTIEAAAKFGRAEALKLETNSFVPLAGSNEARALVGIFLNDQYVK
GQAKKLSKGVSAPKQAAVLGAGIMGGGIAYQSALKGVPVIMKDINDKSLTLGMNEAAKLL
NKQLERGKIDGLKMANILATIQPTLDYAGIERAQIIVEAVVENPKVKAAVLAEVETLIGE
ETVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGTKTSDKTIATIVAY
ATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQTVMAVGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDTKGKP
RKENDEQVDTLLAQVSQPLQKFSDDDIIARTMIPMINEVVRCLEEGIIASPAEGDMALVY
GLGFPPFHGGVFRYLDTIGSANYVEMAQRYTHLGALYQVPPGLRAKAEHNESYYPVAAAL
LDVSISQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaagcgaaacactaaagcttcactggctggaaaacggcattgccgagttg
gtgtttgatgcaccaggttcagttaataagctggatacccaaactgtagccaatctgggc
gaagccttggttgtgttagaaaaacaaagtgaactcaaagggttgctattacgctcagcc
aaagcagcctttattgtcggtgccgatatcaccgagtttctatccctgtttaatgagcca
ccagaaaagttgcatcaatggttggttttcgccaacgatattttcaatcgtttggaagac
ttaccggtgccaaccattgcagcaatcaatggatatgcactgggtggcgggtgtgaatgt
atcttagcgactgattttcgcgtggcctcgccagaagcacgtatcggcctaccggaaact
aaactcggtatcatgccgggcttcggcggttcagttcgcttacctcggctattaggcgca
gacagtgcgctggaaattattgcggctggcaaagacattattgccaaagatgccttaaag
gttgggctggttgacgccgtcgtcgcccccgaaaagttggtcgatgccgcgttaagcatg
ttgagacaagcgattgacggaaaactcgactggcaagctgcacgtcgcccgaaattagag
ccactgaagctcaatccgaccgaagctgcgatgtgctttaccattgccaaaggcatggtc
atgcaagtcgccggtaaacactatccggctcccttgactgccgtaaaaactattgaggcc
gcggcgaaatttggccgcgctgaagcattgaaactggaaaccaatagttttgttccctta
gctggttccaatgaagcgcgggcattagtcggtattttcttgaatgaccaatatgttaaa
ggtcaggctaaaaagctatccaaaggtgtcagcgcccccaaacaggccgcagtgctaggt
gccgggattatgggcggtgggattgcctatcagtcggcactgaaaggtgtgccggtcatc
atgaaagatattaatgacaaatccctcacattagggatgaatgaagcggccaagttgctg
aataagcagctggagcgcggcaagatagatggcctgaaaatggcaaatatcttagcaacc
atccagccaacattagattatgccggtattgaacgcgcccaaatcatcgtggaagcggtg
gtagaaaatccaaaagtcaaagcggcggttctggcagaggttgaaacgcttattggcgaa
gaaactgttctggcttctaacacttccacaattccgattgatcagctcgccaaatccctt
aaacgcccagaaaacttctgtggcatgcatttcttcaatccagtgcaccggatgccattg
gttgaaattattcgtggcaccaaaacctcagataaaactatcgccacgattgtggcatac
gccacacaaatgggtaaaaccccgattgtagtcaatgattgcccaggcttctttgttaac
cgtgttttattcccgtatctggcgggattcggcatgttagtccgagacggtgcggacttc
cgccaaattgataaagtgatggaaaagcaatttggctggccaatgggccctgcttatcta
ttagatgtggtgggcattgataccgcgcaccatgcgcagaccgtgatggccgttggtttc
cctgaacgcatgaataaagattatcgcgatgcggttgacgtgatgtttgataaccaacgg
tttggtcaaaagaatggccaaggcttctaccgctatacccaagatactaagggcaaaccg
cgtaaagagaatgatgaacaagtagatacgttactggcgcaagtcagccagccgcttcag
aaatttagcgatgacgatattatcgcccgtaccatgatcccgatgatcaatgaggtggtg
cgatgcctggaagaaggcattattgccagcccggctgaaggtgatatggcgttggtatat
ggccttggattccctccattccacggcggcgtcttccgctaccttgataccatcggcagt
gcaaattatgtcgaaatggctcaacgctacacccatcttggggcgttgtatcaagtcccg
ccgggattgagagccaaagccgaacataacgaaagctattatcctgtggcagcagcgctg
cttgatgtttctatcagtcaaccggcatga

DBGET integrated database retrieval system