KEGG   Yersinia enterocolitica FORC_002: FORC2_0040Help
Entry
FORC2_0040        CDS       T03890                                 

Definition
(GenBank) formate dehydrogenase
  KO
K00123  formate dehydrogenase major subunit [EC:1.17.1.9]
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
yef00630  Glyoxylate and dicarboxylate metabolism
yef00680  Methane metabolism
yef01100  Metabolic pathways
yef01120  Microbial metabolism in diverse environments
yef01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:yef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    FORC2_0040
  09102 Energy metabolism
   00680 Methane metabolism
    FORC2_0040
Enzymes [BR:yef01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     FORC2_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding
Motif
Other DBs
NCBI-ProteinID: AKF36187
LinkDB All DBs
Position
46305..48716
Genome map
AA seq 803 aa AA seqDB search
MTNHWVDIKNADLIIVMGGNAAEAHPVGFRWAMEAKIHNNAKLLVIDPRFTRTASVADFY
TPIRSGSDIAFLSGVLLYLMTNNKINREYVEAYTNASLLVREDYTFDEGLFSGYDAENRK
YDKTTWNYQLDENGFAKRDVTLQDPRCVWNLLKEHVSRYTPEVVSNICGTPKEDFLQVCE
YLAETSASNKTATFLYALGWTQHSVGAQNIRTMAMIQLLLGNMGMAGGGINALRGHSNIQ
GLTDLGLLSQSLPGYLNLPSEKQPDIDTYLKANTPKTLLPGQVNYWSNYPKFFVSLMKSF
YGDKAQKENGWGYDWLPKWDKGYDVLQYFEMMSQGKVNGYICQGFNPVASFPNKNKVVAS
LSKLKFLVTIDPLNTETANFWQNHGEFNDVDPSKIQTEVFRLPSSCFAEENGSIVNSSRW
LQWHWKGADAPGEALNDGAILAGIFSRLRDMYRREGGAVPEQVLNMTWDYLTPDNPEPEE
VAQESNGKALADITDADGKVLVKKGEQLSTFAHLRDDGTTASGCWIFAGSWTPAGNQMAR
RDNADPSGLGNTLGWAWAWPLNRRILYNRASADPQGKPWDPKRQLLEWDGAKWGGVDIPD
YSAAAPGSDVGPFIMQPEGMGRLFAIDKMAEGPFPEHYEPFETPLGTNPLHPNVISNPAA
RVFKDDLAAMGSHEQFPYVGTTYRLTEHFHYWTKHALLNAIAQPEQFVEIGEKLAAKKGI
KQGDTVKVSSNRGYIKAKAVVTKRIRTLNVHGQEVDTIGIPIHWGYEGVAKKGFIANTLT
PFVGDANTQTPEFKAFLVNVEKV
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccactgggttgacatcaagaacgcagacttaattatcgtcatgggcggtaat
gcggcagaagcgcatccggtggggttccgctgggcgatggaagccaaaatccacaacaat
gccaagttgctggtgatagacccacgctttacccgtactgcatcggtggctgacttctac
acgccaatccgttccggtagcgatattgcgttcctgtccggcgtgttgttgtatctgatg
accaacaacaaaattaaccgcgaatacgtcgaagcttataccaacgccagcttgctggtg
cgggaagactatacctttgatgagggtttattcagtggttatgacgctgaaaaccgcaaa
tacgataaaaccacctggaattaccagctggatgaaaacggctttgccaaacgcgatgtc
acattacaagacccgcgctgtgtgtggaacttgctgaaagaacacgtcagccgttacacg
ccagaggtggtttccaacatctgcggtacgccaaaagaagatttcttgcaggtttgcgaa
tatctcgccgaaaccagtgcgtccaataaaactgccacgttcctgtatgcgttgggctgg
acacagcactcggttggtgcgcagaacatccgtactatggcgatgatccagttgctgctg
ggcaatatggggatggcagggggcggtattaacgccttgcgcggtcactctaatattcag
ggcttaactgacctgggcttgctgtcacaaagcttgccgggctacctgaatttgccgtca
gaaaagcagccggatattgatacgtacctgaaggccaataccccgaaaactttgttaccg
ggccaggttaactactggagtaattacccgaaattcttcgtcagtctgatgaaaagtttc
tacggtgataaagcccagaaagagaacggctggggctacgactggttacctaagtgggat
aaaggctacgacgtcttgcagtatttcgagatgatgtcgcagggcaaagtgaatggctat
atttgccagggctttaacccggtcgcgtcgttcccgaacaaaaacaaagtagtggcatca
ctgtcgaaactgaaattcttggtgactattgacccgctcaatactgaaaccgcgaatttc
tggcaaaaccacggtgaatttaatgatgtcgatccatcgaaaattcaaaccgaggtattc
cgcttgccatccagttgttttgctgaagaaaacggttctatcgttaactccagccgctgg
ctgcaatggcactggaaaggtgctgatgcgccgggcgaagcattgaacgatggcgctatt
ttggccggtatctttagtcgcctgcgtgatatgtaccgccgcgaaggtggtgccgtgcca
gaacaggtgctcaatatgacctgggattatttgacgccagacaatccagagccagaagaa
gtggcacaagaaagcaatggtaaagccctggccgatattaccgatgccgatggcaaagtt
ctggtcaaaaaaggcgagcagctcagcacctttgctcacctgcgcgatgacggcaccacc
gccagtggctgttggatctttgccggtagctggacaccagccggtaaccagatggcacgg
cgcgataatgctgatccatcaggtcttggcaatacgctgggctgggcatgggcatggccg
cttaaccgccgcattctgtacaaccgcgcgtccgctgatccacagggtaaaccttgggat
ccgaaacgccagttactggagtgggatggtgccaaatggggcggcgtcgatattccagat
tacagcgctgccgcgccgggtagtgatgtcgggccgttcattatgcagcctgaaggcatg
gggcgtctgtttgccatcgacaaaatggcagaagggccattcccggaacactatgagcca
ttcgaaacgccgctgggcaccaacccactgcatccgaatgtgatatccaacccagctgcg
cgcgtgtttaaagatgacctggctgcaatgggttctcatgagcagttcccgtatgtcggc
accacttatcgtctgacagaacatttccactactggactaagcatgcgctgctcaatgct
atcgctcagccagaacagtttgtggaaattggcgaaaaactggcggcgaaaaagggcatt
aagcagggtgataccgtgaaagtcagctccaaccgcggctacattaaagccaaggcagtg
gtgaccaaacgtattcgtaccctgaatgttcatgggcaggaagttgacactattggtatc
ccgatccactggggttacgaaggggtggcgaaaaaaggctttattgccaataccctgaca
ccgtttgtcggtgatgctaatacgcaaacgccagagtttaaggcgttcctggtcaacgtg
gaaaaggtgtaa

DBGET integrated database retrieval system