KEGG   Yersinia enterocolitica FORC_002: FORC2_0041Help
Entry
FORC2_0041        CDS       T03890                                 

Definition
(GenBank) formate dehydrogenase
  KO
K00124  formate dehydrogenase iron-sulfur subunit
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
yef00630  Glyoxylate and dicarboxylate metabolism
yef00680  Methane metabolism
yef01100  Metabolic pathways
yef01120  Microbial metabolism in diverse environments
yef01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:yef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    FORC2_0041
  09102 Energy metabolism
   00680 Methane metabolism
    FORC2_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_10 Fer4_9 Fer4_21 Fer4_2 Fer4_6 Fer4 Fer4_4 Fer4_8 Fer4_3 Fer4_17 Fer4_16 Fer4_22 Fer4_13 Fer4_20 Fer4_15 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AKF36188
LinkDB All DBs
Position
48729..49700
Genome map
AA seq 323 aa AA seqDB search
MSLQTQDIIRRSGTNSLTPPPQDRNHQQEVAKLIDVTTCIGCKACQVACSEWNDIRDEVG
HNVGVYDNPADLTAKSWTVMRFSEVEDEESGKLEWLIRKDGCMHCADPGCLKACPSEGAI
IQYANGIVDFQSEHCIGCGYCIAGCPFDVPRMNKDDNRVYKCTLCVDRVGVGQEPACVKT
CPTGAIHFGTKEAMKEVAAGRVSELKTRGFDNAGLYDPAGVGGTHVMYVLHHADKPQLYH
GLPENPTISPTVTFWKGIWKPLAAIGFAATFAASIFHYVGVGPNRVEEEEDEDDKPDSAP
SDTAAKAPEPTTAEHSDDGETRK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcaaactcaagacattatccggcgctctggcaccaattcccttacgccgccg
ccacaggatcgtaaccaccagcaagaggtggccaagcttatcgacgtcaccacctgtatc
ggctgcaaagcctgtcaggtggcctgttcggagtggaacgacattcgtgatgaagtgggc
cataacgtcggggtgtacgataaccccgccgatttgaccgccaagtcatggacggtaatg
cgtttttctgaagttgaagacgaagagagcggcaagctggagtggctgatccgtaaggat
ggctgcatgcattgtgctgatccgggctgtttgaaagcctgtccgtcagaaggcgctatc
attcagtatgcgaatggtattgtcgacttccagtcagagcactgtatcggttgtggttac
tgcatcgccggttgcccgtttgatgttccgcgcatgaacaaagacgacaaccgggtgtac
aaatgtactctgtgcgtcgatcgcgtcggtgtgggtcaggaacctgcctgtgtgaaaacc
tgcccgaccggggcgattcactttggtaccaaagaagcaatgaaagaagtggccgcaggc
cgggttagcgaactgaaaacgcgcggctttgataacgccgggttatatgacccagcgggt
gttgggggcacccacgtgatgtatgtactgcatcatgcggataaacctcagctttatcat
ggtttgccggagaacccgaccatcagcccgacggtcactttctggaaaggcatctggaaa
ccactggccgcgattggctttgccgcgacctttgctgccagtatcttccactacgtgggt
gtcggcccgaatcgggttgaagaagaagaggacgaagacgataaaccggattccgcgcct
tccgataccgcagccaaggctcctgagcctaccaccgctgaacactcagatgacggggag
acgcggaaatga

DBGET integrated database retrieval system