KEGG   Yersinia enterocolitica FORC_002: FORC2_0346Help
Entry
FORC2_0346        CDS       T03890                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
yef00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:yef00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FORC2_0346
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yef02000]
    FORC2_0346
Enzymes [BR:yef01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     FORC2_0346
Transporters [BR:yef02000]
 Other Transporters
  Pores ion channels [TC:1]
   FORC2_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AKF36493
UniProt: A0A0E8JBK9
LinkDB All DBs
Position
412758..413429
Genome map
AA seq 223 aa AA seqDB search
MVIVHHLNNSRSQRILWMLEELQVPYELKRYQRDPGSLLAPPELKKIHPLGKSPVITDGD
LTLAESGAIIEYLQETYDAQGLFKPTGHYDRQQFRYWMHYAEGSLMPLLVMKLIFSRFGG
PPVPWIIRPVAKALGDGVQKNYLNKQIATHRDYLEQHLEKNQWFAGSDFSAADIQMSFPI
EAINMRGGLAGFPKLQDFLVRIHQRPAYQQAIEKGGAFKLENG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgttcaccatctgaataattcacgttcgcagcgtatcctgtggatgttggaa
gagttgcaagtcccctatgaattaaagcgttatcaacgcgatcctggtagcttgctggca
ccaccggagttgaaaaaaatccatcccctggggaaatcaccggtgattactgatggcgac
ctgacactggcggaatcgggtgccatcatcgagtatttgcaggaaacctatgatgcgcag
ggcttgtttaagcccaccggtcattatgatcgtcagcaatttcgttactggatgcattac
gcagaaggctccttgatgccattgctggtgatgaaacttatctttagccgcttcggcggg
ccgcctgtgccgtggattattcgtccggtcgccaaagctttgggtgatggggtgcagaaa
aattatctgaataagcaaattgccactcatcgcgattatctggaacagcatttagaaaag
aatcaatggtttgctggcagcgattttagcgcggcagatattcagatgagctttcctatt
gaggcaataaatatgcgaggtggtcttgcggggttcccgaaactgcaagatttcttagtg
cgcattcatcagcgcccagcttaccaacaggcgattgaaaagggcggcgcgttcaaatta
gaaaacggataa

DBGET integrated database retrieval system