KEGG   Yersinia enterocolitica FORC_002: FORC2_0524Help
Entry
FORC2_0524        CDS       T03890                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
yef00250  Alanine, aspartate and glutamate metabolism
yef00410  beta-Alanine metabolism
yef00430  Taurine and hypotaurine metabolism
yef00650  Butanoate metabolism
yef01100  Metabolic pathways
yef01110  Biosynthesis of secondary metabolites
yef01120  Microbial metabolism in diverse environments
yef02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:yef00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    FORC2_0524
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FORC2_0524
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FORC2_0524
   00430 Taurine and hypotaurine metabolism
    FORC2_0524
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    FORC2_0524
Enzymes [BR:yef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FORC2_0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AKF36671
LinkDB All DBs
Position
605832..607232
Genome map
AA seq 466 aa AA seqDB search
MTRKSLDNYRSDLLDSRFGSKAIRNISENKVFPKEEMREDIAFQIISDELFLDGNARQNL
ATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDMRCVNMMADLWNAPTPKGAQGVG
TNTIGSSEACMLGGMAMKWRWRKKMAAAGKPTNKPNFVCGPVQVCWHKFARYWDVEIREI
PMIPGQLFMDPQRMIEACDENTIGVVPTFGVTYTGNYELPKPLHDALDKLQKDTGLDIDM
HIDAASGGFLAPFVAPDIEWDFRLPRVKSISTSGHKFGLAPLGCGWVIWRDAAALPEELI
FNVDYLGGQVGTFAINFSRPAGQVISQYYEFIRLGREGYTKVQSACYQVAEFLAKEIAPL
GPYEFYCSGGPYEGIPAICFRIKKGAKAGYTLYDLSERLRLRGWQVPAFTLSGKMSDVVV
MRIMCRRGFEMDFAGLLLDDFKSSLKYLSEHPSLGGEASQNSFSHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactagaaaatctctggataattatcgctcagatttattagactctcgctttggctct
aaagcgattcgtaatatttcagaaaataaagtgttccctaaagaggagatgcgcgaggat
attgcttttcaaattatcagtgatgagctatttcttgatggtaatgcgcgacaaaacctc
gcgacattctgtcagacgtgggatgacgataatgtccataaactgatggatctttcaata
aataaaaactggattgataaagaggaatatccgcaatcagcggcaatagatatgcgctgc
gtaaatatgatggctgatttgtggaatgccccaacaccaaagggggcacaaggggtaggg
acgaataccattggttcgtcagaagcttgtatgctgggtggtatggcgatgaagtggcgc
tggcgtaaaaaaatggcagcggcaggtaaacccaccaataaacctaattttgtctgtggg
ccagtacaagtttgttggcataaatttgctcgttattgggatgtggaaattcgagaaatt
cctatgattccagggcaattatttatggacccgcagcggatgatagaggcctgtgacgaa
aataccattggtgtagtgccgacttttggtgtgacttacaccggcaattatgaattaccc
aaacccttgcatgacgcgctggataaactgcaaaaagatactggcctcgatattgatatg
catattgatgcggcgagtggcggctttttagctccctttgttgcgccggatattgagtgg
gacttccgcttgccacgggttaaatcaatcagcacttctgggcataaattcggacttgct
cctttgggatgtggttgggttatttggcgtgatgctgccgctttacctgaagagctgata
tttaatgtcgattatcttggcgggcaggtcggcacatttgctatcaacttctcgcgtccg
gcggggcaagttatttcccaatattatgaatttatacgcctagggcgtgaaggttatacc
aaagtacaaagcgcctgctatcaggtagctgaattcctcgccaaagaaatagccccgctt
gggccttatgaattctattgcagcggcggcccatacgagggcattccagcgatttgtttc
cgcatcaaaaaaggagccaaggcggggtataccctctacgacctctccgagcgtttaaga
ttgcgtggctggcaggttccggcatttacccttagtggcaaaatgtcagatgtggtagtt
atgcgcatcatgtgccgccgtgggttcgagatggatttcgccgggctgctgttggatgat
tttaaatcctcactgaaatacctgagtgaacatccatcccttggaggcgaggcaagtcag
aatagttttagccatacataa

DBGET integrated database retrieval system