KEGG   Yersinia enterocolitica FORC_002: FORC2_1702Help
Entry
FORC2_1702        CDS       T03890                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
yef00020  Citrate cycle (TCA cycle)
yef00480  Glutathione metabolism
yef01100  Metabolic pathways
yef01110  Biosynthesis of secondary metabolites
yef01120  Microbial metabolism in diverse environments
yef01130  Biosynthesis of antibiotics
yef01200  Carbon metabolism
yef01210  2-Oxocarboxylic acid metabolism
yef01230  Biosynthesis of amino acids
Module
yef_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yef_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:yef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FORC2_1702
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FORC2_1702
Enzymes [BR:yef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     FORC2_1702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AKF37849
LinkDB All DBs
Position
1944422..1945675
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYNG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIREYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKDIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIVKGVEGAIQAKTVTYDFERLMDGAKLLKCSEFGDAIIKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaagaaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgatcattccatttattgaaggtgacggcattggcgtt
gatgtgaccccagccatgatcaacgtggtggatgctgcggttaagaaggcctataacggt
gagcgtaaaatctcctggatggaaatttacaccggtgagaaatcaacccatgtttatggc
aaagatgtttggttgccagaagaaacattggacttgattcgtgagtaccgcgttgcaatt
aaaggcccattgaccactccagtgggtggcggtattcgttctctgaacgttgctttgcgc
caacaactcgacttgtatgtgtgcctacgcccagtgcgttattacgaaggtaccccaagc
ccggtaaaacaccctgagttaaccaatatggtgattttccgcgaaaacgcagaagacatc
tatgcgggtatcgaatggaaagccggctcaccagaagctgaaaaagtgattaagttcctg
cgtgaagagatgggcgtgaagaaaatccgcttccctgaacaatgtggtattggtgtaaaa
ccctgttcagaagaagggactaagcgtttggttcgtgctgcaattgagtatgccattacc
aacgatcgtgaatcagtcaccctggttcataaaggcaacattatgaaattcaccgaaggc
gcatttaaagactggggttaccagttagcgcgtgaggaatttggtggtgagctgatcgat
ggcggcccttgggttaaaatcaagaatccaaacaacggtaaggacatcattgttaaagat
gtgattgccgatgctttcctgcaacagatcctgctgcgtccggctgaatatgatgttatc
gcgtgtatgaacctgaatggggattacatttctgatgcattggctgctcaagttggcggt
atcggtattgccccaggtgcaaacattggtgatgagtgcgcattgtttgaagcgactcat
ggtacagcacctaaatatgcgggtcaggataaagtgaacccaggttctattattctgtct
gcagaaatgatgctgcgtcacatgggctggttcgaagccgcagacctaattgttaaaggt
gttgaaggcgcaattcaggccaagacagtcacttatgatttcgaacgtctgatggatggc
gctaagttgctgaaatgtagtgagtttggcgacgccattattaagcatatgtaa

DBGET integrated database retrieval system