KEGG   Yersinia enterocolitica FORC_002: FORC2_2160
Entry
FORC2_2160        CDS       T03890                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
yef00480  Glutathione metabolism
yef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yef00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FORC2_2160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yef02000]
    FORC2_2160
Enzymes [BR:yef01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     FORC2_2160
Transporters [BR:yef02000]
 Other transporters
  Pores ion channels [TC:1]
   FORC2_2160
SSDB
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_N_5 GST_C_6 Jiv90
Other DBs
NCBI-ProteinID: AKF38307
UniProt: A0A0E1NJ23
LinkDB
Position
2446944..2447552
AA seq 202 aa
MKLFYKPGACSLSPHIVLREAGLDFSIESVDLATKKTETGEDYLHINPKGQVPALLLDDG
SLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFVATELHKGFSPLFNPKTPDE
YKAIARERLDKQFSYVDGVLAKHDYLLGSKFSVADAYLFTVTRWATALKLEIKQRSHLDK
YMARVAERPAVKAALAAEDVKK
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaattgttctataaacccggtgcctgctctttgtctccccacattgtgttacgtgaa
gcggggctagacttcagtattgaaagtgtcgatttggcgactaaaaaaactgaaacgggt
gaagactatttgcacatcaacccgaaaggacaagtgcctgctctgctactggatgacgga
agcctactcactgaaggtgtggctatcgtgcaatatctggcagataaagtgcctgatcgc
cacctgattgcaccatcaggcaccctttcccgctaccacgccattgagtggttaaacttc
gttgcgactgaattacataaaggtttcagcccgctgtttaacccgaaaacaccagacgaa
tataaagctatcgcccgtgagcggctggacaaacaattcagttatgtcgatggcgtatta
gcaaaacatgattatttgttaggctcaaaattcagcgtggccgatgcttatctatttacc
gtaactcgctgggcaactgcactgaaacttgaaattaaacagcgcagccatttagataaa
tatatggcgcgggtagcagagcgtccggcagtcaaagcggctctggcagcagaagacgtg
aagaaataa

DBGET integrated database retrieval system