KEGG   Yersinia enterocolitica FORC_002: FORC2_2663
Entry
FORC2_2663        CDS       T03890                                 

Definition
(GenBank) membrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
yef03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yef00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    FORC2_2663
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yef02044]
    FORC2_2663
Secretion system [BR:yef02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   FORC2_2663
SSDB
Motif
Pfam: DotU OmpA DUF268
Other DBs
NCBI-ProteinID: AKF38810
LinkDB
Position
complement(2985545..2986921)
AA seq 458 aa
MSDSSELNPGIPMPSFDQSRDADTNPQALGHFLLDEPSVYTESTQSGAAFSHEATRSPGF
QPYDTAQLRGESVQQRVAKAVASPTPLLEAAQPLLRALSEMPQEIADASQVQILKESLKN
EITLFSVVCDEADISWKKMAIVRYCLCTALDEAAHTMSWGVMSGWSQSNLLNHFEGDNDG
GNKFFLLVGRLSMSPHEYADCLEVLLRILGLGFEGRYSIIEEGDRQLTKIRQGLLTLLQS
TRDTVPTALSPHGLIAHQFRKRRGIFVPVRVSMLLCGFLIAATFIGSKYFLSVPESDLLK
RMEALQRPVIVPTVAVQKLRLAILLKDEIAKQLVSVDETSSRSKVIFKGDTMFQVGSDKV
RSEIMSVIERVAQEVHRVQGAVLIIGHTDSMPINKPGFPNNQVLSEKRAANVARFMEKAG
IPTDKIQFEGKGDTQPVSSNDDAAGRSQNRRVELFVNY
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgagtgatagcagtgaattgaaccctgggataccaatgccctcctttgatcaaagcaga
gatgcggataccaatccgcaggcgttaggccatttcttgcttgatgagccgagtgtttac
accgagagcacacaatctggtgcggcgttcagccatgaggctacgcgctcaccgggtttt
cagccctatgataccgcccaacttcggggcgagagtgtccagcagcgcgtggctaaagcg
gtcgcgtctccaacgccattattggaggcggcacagccattattacgcgccttaagcgag
atgccacaagagatagcggatgcctcgcaggttcagatattaaaagagagcctgaagaat
gagataaccctgtttagtgtggtatgtgatgaagcggatatctcgtggaagaaaatggcg
atcgtccgctattgcttgtgtaccgcgctagatgaagcggctcacactatgtcgtggggc
gtcatgtcgggttggtcgcaaagcaacctgctaaaccattttgaaggtgataatgacggc
gggaataaatttttcctgttagtaggccgtctctcaatgagcccacatgaatatgcggat
tgcttagaggtattgctgaggattttagggctgggttttgaaggccgttacagcattatc
gaagagggtgaccggcaattaaccaaaatccgtcagggattgttgacgttactgcaaagt
acccgcgataccgttcctactgcgctttctccgcatggattaatcgcgcatcagttccgc
aaaaggcgagggatctttgttccggttcgtgtgtcgatgctgctgtgtggtttcttgatt
gcggccacctttattggcagtaaatattttctctccgtacccgaaagcgacttgctgaag
agaatggaagccttgcaacgtccggttatcgtgccaaccgttgcggtacaaaaactacgt
ctggctattttgttaaaagacgagatagcgaagcagttagtgagtgttgatgaaacaagc
agccgcagcaaagtcatcttcaaaggcgacaccatgttccaggtgggttcggataaagtc
cggtccgaaatcatgagtgtcatcgagcgtgttgcgcaggaagttcatcgcgtacaaggg
gcggtgctgattattgggcataccgactctatgccgatcaacaaaccaggtttccctaat
aaccaggtgctttctgagaaacgtgccgccaacgttgcacgctttatggagaaagcgggt
atcccgactgacaaaattcagtttgaagggaaaggggatacgcagccagtcagtagtaat
gacgatgcagccgggcgctcacaaaaccgccgtgtagaactctttgttaattattga

DBGET integrated database retrieval system