KEGG   Yersinia enterocolitica FORC_002: FORC2_3167Help
Entry
FORC2_3167        CDS       T03890                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
yef00473  D-Alanine metabolism
yef00550  Peptidoglycan biosynthesis
yef01100  Metabolic pathways
yef01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:yef00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FORC2_3167
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FORC2_3167
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    FORC2_3167
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:yef01011]
    FORC2_3167
Enzymes [BR:yef01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     FORC2_3167
Peptidoglycan biosynthesis and degradation proteins [BR:yef01011]
 Precursor biosynthesis
  Amino acid ligase
   FORC2_3167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AKF39314
UniProt: A0A0E8KX02
LinkDB All DBs
Position
complement(3560713..3561813)
Genome map
AA seq 366 aa AA seqDB search
MSKLRVGVIFGGKSAEHEVSLQSAKNIVDAIDKEKFDVMLLGIDKQGIWHVNDASNYLLN
AENPALISLNHSNKNVALIPGQEHQQLIATDNASALAQLDVIFPIVHGTLGEDGSLQGLL
RMANIPFVGSGVVGSAVSMDKDITKRLLRDAGLNIAPFITLTRANKDNYRFEQVTAKLGL
PLFIKPANQGSSVGVSKVRNAYEYEQAVALAFDFDHKVLVESAIVGREIECAVLGNDNPQ
ASLCGEVVISDEFYSYDTKYINETGAQVIIPASIDSAVSDNIRAVALAAFRALECRGMAR
VDVFLTADNTIIINEINTLPGFTNISMYPKLWRATGVGSTELITILIELALERHQQDKSL
KSSILK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaaattgcgagtaggtgtgatttttggcggtaaatcagctgaacatgaagtgtca
ttacagtcggccaagaacatcgtagatgcgattgataaagaaaaattcgatgtgatgtta
ttaggtattgataaacaaggaatatggcatgttaatgatgcatctaattacttgttaaat
gcagaaaacccagcattgatttccctgaaccattcaaacaaaaatgtcgcgctgatccca
ggccaagagcatcagcagctgattgctaccgataatgcctctgcattggctcagttggac
gtcattttcccgattgtccatgggacattaggggaggatggatccttgcaaggcctgcta
cgcatggcaaatattccttttgtcggctccggtgttgtgggttctgcggttagcatggat
aaagatattaccaagcgtttattgcgtgatgctgggttgaatattgcaccatttattacc
ctgacacgggcgaataaagataactatcgttttgagcaagttacggcaaaactcgggtta
cctttatttataaagccagcaaatcagggctcctcggttggtgtgagtaaagtgcgtaat
gcatacgaatatgagcaggcggtagcattagcctttgattttgaccataaagtgctggtg
gaatcggctattgttgggcgagaaatcgaatgtgcagttttgggcaatgataatccgcaa
gccagtttgtgtggtgaagtcgttattagcgacgagttttattcctatgacacaaaatat
attaatgaaaccggtgctcaggtcattatccctgcatcaatagacagtgccgtcagtgat
aatattcgtgcagtcgctttagcagcatttcgcgcacttgagtgccgtggtatggctcgg
gtcgatgtttttttaacggccgataacaccataattatcaatgaaataaatacccttcct
ggatttaccaatattagtatgtatcctaaattgtggcgcgctacaggggttggctcgacg
gaattgatcaccatactgattgagctggctttagaacgtcatcagcaagataaatcactg
aaaagctctattcttaagtaa

DBGET integrated database retrieval system