KEGG   Yersinia enterocolitica FORC_002: FORC2_3984Help
Entry
FORC2_3984        CDS       T03890                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
yef00620  Pyruvate metabolism
yef00680  Methane metabolism
yef01100  Metabolic pathways
yef01120  Microbial metabolism in diverse environments
yef01200  Carbon metabolism
Module
yef_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:yef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FORC2_3984
  09102 Energy metabolism
   00680 Methane metabolism
    FORC2_3984
Enzymes [BR:yef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FORC2_3984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKF40131
LinkDB All DBs
Position
4569907..4572543
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGTLLGDTIKEALGEHILEKVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEALAQLFTRLKDKKLSEQD
MRSAVDELSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKIRPSPVDEAKWGFAVVENSLWEGVPAFLREFNEQLQNSLDYRLPVEAV
PIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRDIQVLVSELSMSECTPELRE
LAGGEEVLEPYRELMKRVRTQLTNTQAYLEARLKGERVLPPTDLLVSNDQLWDPLYACYQ
SLKACGMEIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDAIAELTRYLGLGDYESW
SEADKQAFLIRELNSKRPLVPLKWEPSADTQEVLETCRVIAEAPQGSIAAYVISMAKVPS
DVLAVHLLLKEAGCPFTLPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGISLTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYASAVLEANLLPPPEPKKEWNEVMDILS
DASCEMYRGYVRENPQFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQKAIDAGKKEVLATMCRDWPFFSTRIGMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLASDIKVVLAIANDDHLMADLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEHPDARVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaacgtcagtatgctcggtacgctactcggg
gacaccatcaaggaagcgcttggtgaacacatccttgaaaaagtagaaaccatccgtaaa
ttatctaaatcttcgcgtgccggtaatgaagcgagccgtcaggagctactgacgacactg
caaaatttatccaacgacgaactgcttccggtcgcccgtgcttttagccaattcctcaat
ctgacgaatacggcagagcaatatcacagcatttcgccgcatggtgaagccgcaagtaac
ccggaagccctggcccaactgttcacccgcttaaaagacaaaaagctgagtgagcaagac
atgcgcagcgcggttgatgagctatccattgagctggtgctaacggctcacccaactgaa
attacccgccgtaccttgattcataaactggttgaagtgaatacctgcctgagccagttg
gatcacaatgatttagccgattacgaacgcaacaagatcatgcgtcgtttgcggcagtta
gtcgcacaatcatggcataccgacgaaattcgtaaaatccgcccttccccggttgatgaa
gccaaatggggctttgcggtggttgaaaacagcttatgggaaggtgtgccagctttcctg
cgtgaatttaacgagcagttgcaaaactccctcgattaccgcttgccggtagaagcggtg
ccgatccgcttcacttcatggatgggtggcgaccgtgacggtaacccaaatgttaccgct
gaaattacccgccatgtgctattactgagccgctggaaagcgaccgatttattcctgcgc
gatattcaggtattggtgtcagagctttccatgtcggaatgtacgccggaactgcgtgaa
ttggcgggcggcgaagaggtgctcgaaccttatcgtgaactgatgaaacgcgtgcgcact
cagttgaccaatactcaggcttatctggaagcacgcctgaagggcgagcgcgtattaccg
ccaacggatttactggtcagcaatgaccaactgtgggatccgctatacgcctgttatcaa
tccctgaaagcctgtggcatggaaatcatcgccaacggccagttactcgataccttgcgc
cgtgtgcgctgctttggtgtgccattggtgcgtatcgatgtgcgtcaggaaagcacccgt
cataccgatgctattgctgaactgacccgctatctgggcctcggtgattatgaaagctgg
tctgaagcggacaaacaagccttcctgatccgcgaactgaattccaaacgtccactggtt
ccgctgaaatgggaacccagtgccgatacccaagaagtgttggaaacctgccgggtgatt
gccgaagcgccgcaaggttctatcgccgcttatgtgatttccatggcgaaagtgccatcg
gatgtgctggcggtgcatttgctgctgaaagaagccggctgcccattcactctgccagtc
gcgccattgttcgaaacactcgatgacctgaacaatgcggacgacgtgatgacccagtta
ctgaatatcgactggtatcgcggcctgatccaaggcaagcagatggtgatgattggctat
tctgactcagcgaaagacgccggtgtgatggccgcgtcctgggcgcaatatcgggcgcaa
gatgcattaatcaaaacctgcgagaaagccggtatctccctgacactgttccatggtcgc
ggcggttctatcggccgcggtggtgcacccgcccatgccgcgctgctttctcagcctccg
ggcagcctgaaaggcggcttacgtgtcactgaacaaggcgagatgattcgctttaagttt
ggtctgccggaagtcaccatcagcagtctggccctgtatgccagtgcggtgctggaagcc
aatttgttaccgccgccggaaccgaagaaagagtggaatgaggtgatggatattctgtct
gatgcctcttgtgagatgtatcgcggctatgtgcgtgaaaatccacagttcgtgccttac
ttccgcgccgccacccctgaactggaattgggcaagctgccattgggttcgcgcccagcc
aaacgccgcccgaatggcggggtggaaagcctgcgtgctattccgtggatctttgcctgg
acccaaaaccgcctgatgttaccggcctggctgggtgccggtgccggtttacagaaagcc
atcgatgccggtaagaaagaagtattagccaccatgtgtcgtgactggccgttcttctca
acccgcattggtatgctggaaatggtgtttgccaaagccgatttgtggctggccgaatat
tatgaccaacgtctggtggataagtcattgtggccattaggacagcaattacgcgaccaa
ctggcatctgatattaaagtggtgctggccattgccaacgacgatcacttgatggctgat
ttgccgtggattgccgagtcgattgcgctgcgtaacgtctataccgacccattaaacgtg
ttgcaagccgaactgttgcaccgttcacgccaacaagaacaccctgatgcccgcgttgag
caagcattgatggtgaccatcgctggggtggcagcagggatgcgtaataccggttag

DBGET integrated database retrieval system