KEGG   Yersinia enterocolitica LC20: LC20_00047Help
Entry
LC20_00047        CDS       T03179                                 

Gene name
fdxH
Definition
(GenBank) formate dehydrogenase subunit beta
  KO
K00124  formate dehydrogenase iron-sulfur subunit
Organism
yel  Yersinia enterocolitica LC20
Pathway
yel00630  Glyoxylate and dicarboxylate metabolism
yel00680  Methane metabolism
yel01100  Metabolic pathways
yel01120  Microbial metabolism in diverse environments
yel01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:yel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LC20_00047 (fdxH)
  09102 Energy metabolism
   00680 Methane metabolism
    LC20_00047 (fdxH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_10 Fer4_9 Fer4_21 Fer4_2 Fer4_6 Fer4 Fer4_4 Fer4_8 Fer4_3 Fer4_16 Fer4_17 Fer4_22 Fer4_13 Fer4_20 Fer4_15 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AHM71303
LinkDB All DBs
Position
51302..52273
Genome map
AA seq 323 aa AA seqDB search
MSLQTQDIIRRSGTNSLTPPPQDRNHQQEVAKLIDVTTCIGCKACQVACSEWNDIRDEVG
HNVGVYDNPADLTAKSWTVMRFSEVEDEESGKLEWLIRKDGCMHCADPGCLKACPSEGAI
IQYANGIVDFQSEHCIGCGYCIAGCPFDVPRMNKDDNRVYKCTLCVDRVGVGQEPACVKT
CPTGAIHFGTKESMKEVAAGRVAELKTRGFDNAGLYDPAGVGGTHVMYVLHHADKPQLYH
GLPENPTISPTVTFWKGIWKPLAAIGFAATFAASIFHYVGVGPNRVEEEEDEEHKPDATP
SATVSKEPEQTTTEHSDDGETRK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgcaaactcaagacattatccggcgctccggcaccaactcccttacgccgccg
ccgcaggatcgtaaccatcagcaagaggtggccaaacttatcgacgtcaccacctgtatt
ggctgtaaagcttgtcaggtggcgtgttcggagtggaacgatattcgtgatgaagtcggt
cataacgtcggggtgtacgataaccccgccgatttaaccgccaaatcatggacggtgatg
cgcttctcggaagtggaagatgaagagagcggcaagctggaatggctgatccgcaaggat
ggctgcatgcattgtgctgatccgggctgcttgaaagcctgcccgtcggaaggggctatc
attcaatatgcgaatggtattgttgacttccagtcagagcactgcatcggctgtggttat
tgcatcgccggttgcccgttcgatgtgccgcgcatgaacaaagacgataaccgggtgtac
aaatgtacgctctgtgtcgatcgtgtgggtgttggtcaggaaccggcctgtgtgaaaacc
tgcccgaccggggcaattcactttggcaccaaagagtcgatgaaagaagtggcagcaggc
cgagtggcggaattgaaaacccgtggctttgataacgccgggttatatgacccggcgggc
gtcggcggcacccatgtgatgtatgtgctgcatcatgcggataaacctcagctttatcat
ggtttgccggagaacccgacgatcagcccgacggtcactttctggaagggtatttggaaa
ccactggcggcgattggtttcgctgcgacatttgctgccagtatcttccattacgttggc
gttggcccgaaccgggtggaagaagaagaggacgaagagcataaaccggatgccactcct
tctgctacagtgtccaaggaaccagagcagaccaccactgagcactcagacgacggggag
acgcggaaatga

DBGET integrated database retrieval system