KEGG   Yersinia enterocolitica LC20: LC20_00242Help
Entry
LC20_00242        CDS       T03179                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
yel  Yersinia enterocolitica LC20
Pathway
yel00564  Glycerophospholipid metabolism
yel01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LC20_00242
Enzymes [BR:yel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LC20_00242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AHM71498
UniProt: A0A2K7ZCL7
LinkDB All DBs
Position
complement(240444..241958)
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWREQG
LWVVEAIDVNTGKTLTWRAKGLVNATGPWVKQFFDDGLNLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDDYSIIGTTDVEYHGSPQDVKIDDQEIDYLLKVYNDHF
NKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEGGKAPLLSVFGGKLTTYRK
LAEHALEKLSGYYPNVGPAWTKNGALPGGDIGGNRDNYTVQLRHRYNWLPEGLARRYTRT
YGSHSELILADATNIESLGEHFGHGLYEAELRYLVDKEWVVELDDAIWRRTKLGMILDDA
QKQRVAEWLAEVQAGKQQTLSLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggcattaacggtgccggtatcgctgcg
gacgctgcagggcgtggcctgtccgttctgctgctggaagcacaagatttggcctgtgct
acgtcttcggccagctccaaactgatccacggtggcctgcgctatctggaacactacgag
ttccggctagtcagtgaagcactggccgagcgtgaggtgttgctaaagttggccccgcac
attgctttcccgatgcgctttcgcctgccccatcaaccccatctacgcccggcttggatg
attcgtaccggtttattcttatacgaccatttgggcaaacgcaccagtttacctgccagt
aaagggctgcgttttgggccagaatccgtattgaaaccggagctggtgcgcggtttcgaa
tattctgactgctgggtcgatgatgcccgtttggtggtgctgaacgcgcaagaagtggtc
gagcgcggtggcgaagttcgtacccgaaccaaagtgaccagagcttggcgtgaacaaggc
ctgtgggtagtggaagccattgatgtaaacaccggtaagaccttgacttggcgcgctaaa
gggttggtaaatgccaccggcccatgggttaaacagttcttcgatgatgggctgaatctg
aaatcaccttatggtatccgcttgatcaaaggcagccatattgttgtgccacgggttcat
aaccaaccgcaggcctatattctgcaaaacgaagaccaccgcattgtctttgtcattcca
tggttggatgattattccatcatcggcaccactgacgtggaataccacggctcgccgcaa
gatgtgaaaattgacgaccaagaaattgattacttgctgaaggtgtataacgaccacttt
aacaagcaattgggccgtgatgatatcgtctggacatactctggtgtccgtccattatgc
gatgatgaatcagactcaccacaagcggtgactcgcgattacacactggatgtggctgat
gagggtggcaaagcgccgttgctgtcggtgtttggtggcaaactaaccacttaccgtaaa
ctggcagagcacgcgctggaaaaactgtccggctactatccgaatgtcggcccggcatgg
acaaaaaacggcgctttaccgggcggagatattggcggcaaccgtgacaactatactgtg
cagctgcgccatcgctataactggctaccggaagggttggcacgccgctatacccgaact
tatggcagccacagtgaactgattctggcggatgccaccaacatcgaaagcctgggcgaa
cacttcggccatggcttgtatgaagcagaattgcgctatctggttgacaaagagtgggtc
gttgaacttgatgacgccatttggcgtcgcaccaagttaggtatgattctggatgatgcg
cagaaacagcgtgttgccgaatggctggcagaagtacaggccgggaaacaacagacactc
tctctggtttcttga

DBGET integrated database retrieval system