KEGG   Yersinia enterocolitica LC20: LC20_00861Help
Entry
LC20_00861        CDS       T03179                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
yel  Yersinia enterocolitica LC20
Pathway
yel00250  Alanine, aspartate and glutamate metabolism
yel00410  beta-Alanine metabolism
yel00430  Taurine and hypotaurine metabolism
yel00650  Butanoate metabolism
yel01100  Metabolic pathways
yel01110  Biosynthesis of secondary metabolites
yel01120  Microbial metabolism in diverse environments
yel02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:yel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LC20_00861
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LC20_00861
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LC20_00861
   00430 Taurine and hypotaurine metabolism
    LC20_00861
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LC20_00861
Enzymes [BR:yel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LC20_00861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AHM72117
UniProt: A0A2K7ZE07
LinkDB All DBs
Position
complement(776587..777987)
Genome map
AA seq 466 aa AA seqDB search
MTKKILDDSRSTLLDSRFGSQAIRNISENKYFPKEEMREDIAFQIISDELLLDGNARQNL
ATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDMRCVNMMADLWNAPRQKDGQGVG
TNTIGSSEACMLGGMAMKWRWRKKMKAAGKPFDKPNFVCGPVQVCWHKFARYWDVEIREI
PMIPGQLFMDPQRMIEACDENTIGVVPTFGVTYTGNYELPKPLHDALDKLQKDTGLDIDM
HIDAASGGFLAPFVAPDIEWDFRLPRVKSISTSGHKFGLAPLGCGWVIWRDAAALPEELI
FNVDYLGGQVGTFAINFSRPAGQVISQYYEFIRLGREGYTKVQSACYQVAEFLAKEIAPL
GPYEFYCSGGPQQGIPAICFRIKEGAKVGYTLYDLSERLRLRGWQVPAFTLSGKMSDVVV
MRIMCRRGFEMDFAGLLIDDFKTSLKYLSEHPSLGGEASQNSFSHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaattttggatgactctcgctcaactttattagactctcgctttggttct
caagcgattcgtaatatttcagaaaacaaatattttcctaaagaggaaatgcgtgaggat
atcgcctttcaaatcataagtgatgagctattgcttgatggaaatgcgcgacaaaacctc
gccacattctgtcagacgtgggatgacgataatgtccacaaactgatggatctttcgata
aataaaaactggattgataaagaggaatatccgcagtcagcggcgatagatatgcgctgt
gtcaatatgatggctgacttgtggaatgctccgcgacaaaaggatgggcaaggggttggc
acgaatactattggttcttcagaagcttgcatgctaggtggcatggccatgaagtggcgc
tggcgcaaaaaaatgaaagccgctggtaaaccttttgataaaccaaattttgtctgtggc
ccggtgcaagtttgctggcataagtttgctcgttattgggatgtcgaaattcgtgaaatt
ccgatgattcccgggcagctatttatggatccacagcggatgattgaagcgtgtgatgaa
aataccattggcgtcgtccccacttttggggtgacttacaccggcaattatgagttacca
aaacctttgcatgacgcattggataaactgcaaaaagataccggtcttgatattgatatg
catattgatgcggcgagtggcggctttttggccccctttgttgcgcccgatattgagtgg
gatttccgtttaccacgggtgaaatcaatcagtacttccgggcataaatttgggctagca
cctttgggatgtggttgggttatctggcgtgatgccgcggctttacctgaagagttgata
tttaatgttgattatcttggcggccaagtcggcacttttgcgattaacttctcgcgtccg
gcagggcaagttatttcccaatactatgaatttatacgtttagggcgtgagggttatacc
aaagtacaaagtgcctgctatcaggtggcagaatttttggctaaagagattgccccattg
gggccctatgaattctattgtagtggtggcccacagcagggtattcctgcgatttgtttc
cgtatcaaagaaggggctaaagtcgggtataccttatatgacctttctgagcgcctgaga
ctgcgtggttggcaagttccagcatttactctaagcggaaagatgtctgatgtcgtggtg
atgcgcatcatgtgccgtcgcggattcgagatggatttcgcggggttattaatcgatgat
tttaaaacttcactgaaatacctgagtgagcatccatccctagggggcgaggcgagccag
aatagttttagtcatacctaa

DBGET integrated database retrieval system