KEGG   Yersinia enterocolitica LC20: LC20_00900
Entry
LC20_00900        CDS       T03179                                 

Definition
(GenBank) type VI secretion system contractile sheath small subunit
  KO
K11901  type VI secretion system protein ImpB
Organism
yel  Yersinia enterocolitica LC20
Brite
KEGG Orthology (KO) [BR:yel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yel02044]
    LC20_00900
Secretion system [BR:yel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LC20_00900
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AHM72156
LinkDB
Position
812951..813451
AA seq 166 aa
MSSSSFQNEIPKARINIKLDLHTGGAQKKMELPLKLLVMGDYSNGQEQRPLSEREKLNIN
KNNFNSVLAEFQPSLKLAVPDTLAGDNTDTAVALTFRDMKDFEPENVARQIPQLRALLAM
RNLLRDLKSNLLDNATFRRELENILKDEALSDELRAELAALAPKDC
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtcctcttcaagcttccaaaatgaaatacctaaagcacgcattaatattaagcttgac
ctgcatacaggtggcgctcaaaagaaaatggagctgcctttaaagttgttggtgatgggt
gattacagcaacggtcaggaacagcgcccgctgtctgaacgtgaaaaactcaatatcaat
aagaacaatttcaatagcgttctggctgaattccaaccgagcctgaaactcgcggtaccc
gacacgctggctggtgataacactgataccgctgttgctttgacctttcgtgacatgaaa
gatttcgaaccggaaaacgtcgcccgtcaaatcccacaactgcgtgccttgctggcaatg
cgcaatctgctgcgtgatctcaagtccaatttgctggacaacgccaccttccgccgtgag
ctggaaaacatcctcaaagacgaagcattgagcgatgagctgcgtgctgaactggcggca
ttggcccccaaagactgttaa

DBGET integrated database retrieval system