KEGG   Yersinia enterocolitica LC20: LC20_02779Help
Entry
LC20_02779        CDS       T03179                                 

Definition
(GenBank) 3-ketoacyl-ACP reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
yel  Yersinia enterocolitica LC20
Pathway
yel00061  Fatty acid biosynthesis
yel00780  Biotin metabolism
yel01100  Metabolic pathways
yel01110  Biosynthesis of secondary metabolites
yel01130  Biosynthesis of antibiotics
yel01212  Fatty acid metabolism
Module
yel_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:yel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LC20_02779
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LC20_02779
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LC20_02779
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yel01004]
    LC20_02779
Enzymes [BR:yel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     LC20_02779
Lipid biosynthesis proteins [BR:yel01004]
 Fatty acid synthase
  Component type
   LC20_02779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase GDP_Man_Dehyd NAD_binding_10 NmrA RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 DUF1776 TrkA_N Ribosomal_S11 Adenine_deam_C
Motif
Other DBs
NCBI-ProteinID: AHM74032
LinkDB All DBs
Position
complement(2418021..2418761)
Genome map
AA seq 246 aa AA seqDB search
MTNSTQQVAIVTGASRGIGAAIAERLAQDGYTVVINYSQAGDKAEALVRKIEQAGGHAMS
VQGDVSDPAAVAQLFATAEAAFGGVDVLVNNAGIMSLSTIADSDDEHFDRQMAINVKGSF
NAMREAAKRLRKGGRIVNFSTSVVGLKLEKYAVYAATKAAVETMTAILAKEMRGRNITVN
AVAPGPTATDLFLQGKPAELIEKMAQMTPLERLGTPEDIAAAVSFLVGKDGGWINGQVLR
ANGGLI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacgaattccactcaacaggtcgctattgttacaggtgcatcaaggggaattggcgcg
gcaatcgctgagcgcttggcgcaggatggctatacggttgttatcaattattctcaggct
ggtgataaagccgaagcattggtgcgtaaaattgaacaagcgggagggcatgcaatgagt
gtgcaaggtgatgttagtgatcccgctgctgtggctcaattatttgcaacagcagaggct
gcttttggtggtgtggatgttttggtcaataacgccggcattatgtcactcagtaccatt
gccgacagtgatgatgaacattttgaccgccagatggcaattaatgtgaaaggcagcttc
aacgcaatgcgggaagccgcgaaacggttgagaaagggcggccgcatcgtcaatttttcc
acgagtgtcgtggggctgaagttagaaaaatatgctgtttatgcggcgaccaaagccgca
gtggaaacaatgacggcaatcctggcaaaagagatgcgcggtcgcaatattactgttaat
gccgtggcaccagggccaacagctacggatcttttcctgcagggtaaacccgcagaactg
attgaaaaaatggcccaaatgaccccactggaaagattaggcaccccagaagacattgcg
gcggcggtatcatttttggttggtaaagatggcggttggatcaatgggcaagtgctgcgc
gccaatggcggcctgatttag

KEGG   Yersinia enterocolitica LC20: LC20_03346Help
Entry
LC20_03346        CDS       T03179                                 

Definition
(GenBank) 3-oxoacyl-ACP reductase FabG
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
yel  Yersinia enterocolitica LC20
Pathway
yel00061  Fatty acid biosynthesis
yel00780  Biotin metabolism
yel01100  Metabolic pathways
yel01110  Biosynthesis of secondary metabolites
yel01130  Biosynthesis of antibiotics
yel01212  Fatty acid metabolism
Module
yel_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:yel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LC20_03346
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LC20_03346
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LC20_03346
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yel01004]
    LC20_03346
Enzymes [BR:yel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     LC20_03346
Lipid biosynthesis proteins [BR:yel01004]
 Fatty acid synthase
  Component type
   LC20_03346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase Sacchrp_dh_NADP Seadorna_Vp10 ADH_zinc_N THF_DHG_CYH_C PAC2
Motif
Other DBs
NCBI-ProteinID: AHM74599
LinkDB All DBs
Position
complement(2867228..2867962)
Genome map
AA seq 244 aa AA seqDB search
MSFEGKIALVTGASRGIGRAIAELLAERGARVIGTATSEKGAEAISAYLGENGKGLMLNV
VDPASIESVLATIRAEFGEVDILVNNAGITRDNLLMRMKDEEWQDIIDTDLTSVFRLSKA
VMRAMMKKRFGRIITIGSVVGTMGNAGQVNYAAAKAGLIGFSKSLAREVASRGITVNVVA
PGFIETDMTTALTDDQRAGILAQVPANRLGQAKEIASAVAFLASDEASYISGETLHVNGG
MYMI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgaaggaaaaattgcgctggtaactggcgctagccgcggtattggccgtgcg
attgcagaattactggctgaacgtggtgcccgtgttattggtacggcaaccagtgagaag
ggcgcagaagcaattagcgcctacttaggtgagaatggcaaaggtttaatgctgaatgtc
gtggaccccgcgtcaatcgagtctgttttggcaacgattcgtgcggaatttggagaagtc
gacattttagtgaataatgcaggtattacgcgtgataacctgctgatgcgtatgaaggat
gaagagtggcaggatattattgacactgatctaacttccgtattccgcctgtcaaaagcg
gtaatgcgcgctatgatgaaaaagcggtttgggcgtatcatcaccatcggttctgtggtt
gggacaatgggcaatgcggggcaggttaactacgcggcagctaaagcgggtctgatcggt
tttagcaagtctttggcgcgtgaggttgcttcacgtggcattactgtcaacgttgtggca
cctggctttattgagacggacatgacgacggcgttgacagatgatcaacgcgcaggcatt
ttagcccaagtaccagctaaccggcttgggcaagcaaaagaaatcgccagcgctgttgca
tttttagcctctgacgaggccagctacatctctggtgaaacattacatgtcaatggcggc
atgtatatgatttaa

KEGG   Yersinia enterocolitica LC20: LC20_04362Help
Entry
LC20_04362        CDS       T03179                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
yel  Yersinia enterocolitica LC20
Pathway
yel00061  Fatty acid biosynthesis
yel00780  Biotin metabolism
yel01100  Metabolic pathways
yel01110  Biosynthesis of secondary metabolites
yel01130  Biosynthesis of antibiotics
yel01212  Fatty acid metabolism
Module
yel_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:yel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LC20_04362
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LC20_04362
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LC20_04362
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yel01004]
    LC20_04362
Enzymes [BR:yel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     LC20_04362
Lipid biosynthesis proteins [BR:yel01004]
 Fatty acid synthase
  Component type
   LC20_04362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: AHM75615
LinkDB All DBs
Position
complement(3771037..3771771)
Genome map
AA seq 244 aa AA seqDB search
MSRQWVLITGGSRGIGRALVEELAKEWDVVFTWRNGEQQSRDVIDGCEGLAGRVTGYRCD
GSNEAEVDALAPQLLEKYGPPGAVIHNAGITGDSLHIQQNGDNWRNVLDTNLNAIFYWNK
HLLPPMMMQGEGAILLMSSVTAIKGNIGQSAYGASKAAMLGLGRSLALEMGRFNIRVNCL
LPGIIDSDMTRDMPADALKGLRKQIPLRRLGNAQEVARVSAFMIGNDSRYMTGQTLVLDG
GLTA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcaatgggtattaattacagggggaagccgtggcattggccgcgcattggtc
gaagagctggccaaagagtgggatgttgtttttacctggcgcaatggtgaacaacagagc
cgtgatgtcatcgacggctgtgaagggctcgccggtagggtcactggttatcgctgtgac
ggcagtaatgaagcggaagttgatgcgctagccccacaattgttagaaaaatatggcccg
cccggcgcggtcattcataatgcgggcattaccggtgatagcttacatatccaacagaat
ggtgataattggcgcaatgttctggataccaatctcaatgccattttttactggaataaa
catctattgccaccaatgatgatgcagggcgagggggcaattttgttgatgtcttcagtg
accgccatcaaaggcaatattggacaaagcgcgtatggcgcgagtaaagcggcaatgctg
ggtcttggccgttcgctggcacttgagatggggcgctttaatattcgggtgaattgtttg
cttccagggataattgacagtgatatgacacgcgacatgcctgcggatgccttaaaagga
ttacgtaaacagatcccattacgacgtttgggtaatgcacaagaagttgctcgtgtcagc
gcctttatgataggcaatgacagccgctatatgaccggccaaaccttggtgttagatggc
ggattaacggcttaa

DBGET integrated database retrieval system