KEGG   Yersinia enterocolitica LC20: LC20_04362Help
Entry
LC20_04362        CDS       T03179                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
yel  Yersinia enterocolitica LC20
Pathway
yel00061  Fatty acid biosynthesis
yel00780  Biotin metabolism
yel01100  Metabolic pathways
yel01130  Biosynthesis of antibiotics
yel01212  Fatty acid metabolism
Module
yel_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:yel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LC20_04362
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LC20_04362
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LC20_04362
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yel01004]
    LC20_04362
Enzymes [BR:yel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     LC20_04362
Lipid biosynthesis proteins [BR:yel01004]
 Fatty acid synthase
  Component type
   LC20_04362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: AHM75615
LinkDB All DBs
Position
complement(3771037..3771771)
Genome map
AA seq 244 aa AA seqDB search
MSRQWVLITGGSRGIGRALVEELAKEWDVVFTWRNGEQQSRDVIDGCEGLAGRVTGYRCD
GSNEAEVDALAPQLLEKYGPPGAVIHNAGITGDSLHIQQNGDNWRNVLDTNLNAIFYWNK
HLLPPMMMQGEGAILLMSSVTAIKGNIGQSAYGASKAAMLGLGRSLALEMGRFNIRVNCL
LPGIIDSDMTRDMPADALKGLRKQIPLRRLGNAQEVARVSAFMIGNDSRYMTGQTLVLDG
GLTA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcaatgggtattaattacagggggaagccgtggcattggccgcgcattggtc
gaagagctggccaaagagtgggatgttgtttttacctggcgcaatggtgaacaacagagc
cgtgatgtcatcgacggctgtgaagggctcgccggtagggtcactggttatcgctgtgac
ggcagtaatgaagcggaagttgatgcgctagccccacaattgttagaaaaatatggcccg
cccggcgcggtcattcataatgcgggcattaccggtgatagcttacatatccaacagaat
ggtgataattggcgcaatgttctggataccaatctcaatgccattttttactggaataaa
catctattgccaccaatgatgatgcagggcgagggggcaattttgttgatgtcttcagtg
accgccatcaaaggcaatattggacaaagcgcgtatggcgcgagtaaagcggcaatgctg
ggtcttggccgttcgctggcacttgagatggggcgctttaatattcgggtgaattgtttg
cttccagggataattgacagtgatatgacacgcgacatgcctgcggatgccttaaaagga
ttacgtaaacagatcccattacgacgtttgggtaatgcacaagaagttgctcgtgtcagc
gcctttatgataggcaatgacagccgctatatgaccggccaaaccttggtgttagatggc
ggattaacggcttaa

DBGET integrated database retrieval system