KEGG   Yersinia enterocolitica LC20: LC20_06985Help
Entry
LC20_06985        CDS       T03179                                 

Definition
(GenBank) ATP-dependent dsDNA exonuclease
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
yel  Yersinia enterocolitica LC20
Brite
KEGG Orthology (KO) [BR:yel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:yel03400]
    LC20_06985
DNA repair and recombination proteins [BR:yel03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LC20_06985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SbcCD_C AAA_23 AAA_29 AAA_21 SMC_N ABC_tran NTPase_1 cobW AAA_25 MMR_HSR1 AAA_28
Motif
Other DBs
NCBI-ProteinID: ATX62761
LinkDB All DBs
Position
complement(1192269..1195958)
Genome map
AA seq 1229 aa AA seqDB search
MRILSLRLKNINSLQGEWKIDFTAEPFASSGLFAITGPTGAGKTTLLDAICLALYHQTPR
LNVTPSQNELMTRHTAESLAEVEFEVKRTRYRAFWSQRRAKNSPEGNLQAPKVELALCED
GKILADKVRDKLDMIAAITGLDFGRFTKSMLLSQGQFAAFLNADANDRAELLEELTGTDI
YGRLSEHVFEQHKQAKLALDTLHQRASGIELLNEEQRLALAQQLDALSEQEKQFTAEQHV
NQNQINWLTHWQQQQKNVLEYQQQQQLIEQEYQQAQPELQRLARSEPAEKLRPLLHERAR
SLQDLQQIQLRVTTLTAQQKQLQTQLTPLAHALEQANLARQQQAARQHEQETLIEQKVVP
LDNIIAQQQHALMLLATQLQQLRSKEQHSKQQVELNEQQLKQTHQRWQQLTEYTHQYAHH
QHWEKNLPLWREQFRQLHIQQKQLVESEQQLQQEVALLSSLQQQIATLNEQEKQQQTALA
QANAQAGSIQQQLSALEQQQPLAQLHQQLSELQQQRPVRQQLAALSPLAQQVQALHDKQQ
QQLAGQQQQRQQLEHQLAEKRQLYKQQKQHLTDLEALLESEKKIVKLEAERAKLQPGKAC
PLCGALDHPAIIEYQSVKPSETAMRVEELRLQVEQLFTVGTELRTQVANAQQQQLRLEQE
LQYSQQQLTDYQQQWQTLTQPLALTFALNEPTALAAWLQQQEQSEQICQQRRTEYEQLNQ
QYQQAKDILAQVEQQQQKHQQQLAFVIQRQQDAQQSHQKLLLQQQHQQAEWVKTRQDFSH
TLAELSLSLPETDQQQNWLSLREEENQHWQQYQQELQQLALAQKALEIQIENERRHLQEC
IDQLSALSQQHQQAETLLQQQQQQRQALFGDIQVTEARQLLRQQQQQAELAQQNASHALQ
QAQSQLNLLSGELAALLQQKQQSQLRAAAAQTELQHALADSEFKDEDALTSALLSEEERQ
RLQQLKQQLSERLQQAHIRQQQASDALAQLILSCPAGVSQTSELAILQQRSEQLLAQLKA
NTLRQGELRNQLESDTVRRGNQHTLFEQIERSQQQYDDWSYLNHLIGSKEGDKFRKFAQG
LTLDHLVYLANNQLSRLHGRYQLQRKTSDALELQVVDTWQADAIRDTRTLSGGESFLVSL
ALALALSDLVSHKTSIDSLFLDEGFGTLDAETLDTALDALDSLNASGKTIGVISHVEAMK
DRIPVQIKVKKVNGLGVSRLDNIFRVNQD
NT seq 3690 nt NT seq  +upstreamnt  +downstreamnt
atgagaattttaagtttacggctgaaaaatattaattctctacaaggtgaatggaagatt
gatttcactgcagagccctttgccagcagcggattattcgctatcaccggcccgacaggg
gcgggtaaaaccacgctgcttgatgccatttgtctcgcgctataccaccaaactccgcgt
ttgaatgtcactcctagccaaaacgaactgatgactcgccacactgcggagtcgctagct
gaagttgaattcgaggtaaaaagaacacgttatcgcgcgttctggagccagcgccgtgcc
aaaaatagcccggagggaaatctacaagcccctaaagttgagctggcgctgtgtgaagat
ggcaaaattctggcggataaagtgcgtgataagcttgatatgattgctgcgatcaccgga
ctggattttggccgtttcaccaaatcaatgttgctatctcaggggcaattcgccgcgttc
cttaatgccgatgctaatgaccgcgcggaattattggaagaattaaccggcaccgatatc
tatgggcggttatctgaacatgtttttgaacagcataagcaggccaagctcgcgctagat
acattgcaccaacgtgccagtggtattgagcttcttaatgaagagcagcgtttagcttta
gcacaacaattagatgcactcagtgaacaagaaaaacagttcaccgcagagcaacacgtg
aatcaaaaccaaataaattggctcacccattggcaacagcagcaaaaaaatgtactcgaa
tatcaacaacagcagcagctcattgagcaagaatatcaacaagcacagcccgaactgcaa
cgactggcccgcagtgaacccgcagaaaagttacgccccttattgcatgagcgcgcacgt
agcctacaggatttgcagcagatacaactgcgtgttaccacactgacagcacaacaaaag
caacttcagacacaacttacaccactagcccacgcactggaacaggccaatcttgctcgc
caacagcaagcagctaggcagcatgaacaagaaacactgatcgagcaaaaagtcgttcca
ctggataacattattgctcaacagcagcacgcattaatgctacttgccacacaactacag
cagttacgtagtaaagaacagcatagtaaacaacaagttgaattaaatgagcaacagtta
aagcaaacccaccagcgctggcaacaactgacggagtatacccaccagtatgctcatcat
cagcactgggaaaaaaatctacccttgtggcgagagcaatttcgccaattacatattcag
caaaaacaattggttgaaagcgagcagcaattacagcaagaagtcgcattgctcagctcc
ttacaacagcaaatcgccacactaaatgaacaagaaaaacaacagcaaaccgcattagcc
caagccaatgctcaggcgggcagcattcagcaacaattgtcagcacttgaacagcaacaa
cctttagcacaattacaccaacagctgtctgaactccagcaacagcggccagtgcgacaa
caattagccgcgttatcgccgctggcacaacaagtacaagcgctgcatgacaaacaacag
caacaattagcgggtcaacaacagcagcgacaacaactcgaacatcagttggcagaaaaa
cgtcagttatataaacaacaaaaacaacatctgacggatctggaagctttactggaaagc
gaaaaaaaaatagtcaagttagaggcagagagagccaaattgcaaccagggaaggcatgc
ccattatgtggggcattggatcaccccgctattattgagtatcaatcagtcaaaccctca
gaaacggccatgcgagttgaagaactgcgacttcaggttgagcagcttttcactgtagga
acagaattacgcactcaggtagcaaatgcacaacagcagcagttacgcctagagcaagag
ctacagtacagccagcagcaattgactgattatcaacaacaatggcaaacactgacacaa
ccactggcgctgacatttgccttgaatgaacctacggctttagccgcctggttacagcaa
caggaacaatcagagcaaatctgccaacagagacggactgaatatgaacagctgaatcag
caatatcaacaagctaaagatattctggctcaggtagaacagcagcagcagaaacatcag
cagcaattagcattcgtgattcagcgccaacaagatgcccagcaatctcaccagaaactg
cttttacaacagcaacatcaacaagctgagtgggtaaaaacgcgtcaagattttagtcat
accctggcagaactatcactctcgctacctgaaacagaccaacaacagaactggctatct
ctgcgagaagaagaaaatcaacactggcagcagtaccagcaagagctgcagcagttggct
ctagcccaaaaagcgctggaaattcagattgaaaatgagcgtcgccatttacaagaatgc
attgaccagctctcggcgctcagccaacagcatcaacaagccgaaaccttgttacagcaa
caacagcaacaacgccaggcactgtttggtgatattcaggtgacagaggcacgccagtta
ttacgccaacagcagcaacaggccgagttggcacagcagaatgcatctcacgcgctgcaa
caggcacaatctcaacttaacttgctatccggtgagttagcggcgctgctacagcaaaaa
cagcaaagtcagctgcgcgcggctgcagcccaaactgaattacaacacgcattggcagac
agtgaatttaaggatgaggatgccttaaccagcgcattactcagtgaagaagaaaggcaa
cgtttgcagcaattaaaacaacaattgagcgaacggctgcaacaagcacacatccgccag
cagcaagccagtgacgcgctagcacaacttatactctcttgccccgcaggggtcagccaa
acctccgaattggcaatattacaacagcggtcagagcagttactggcccaactgaaagcc
aatacattacggcaaggcgaattacgcaatcagttagaaagcgacacggttcgccgtggc
aaccaacatacgttatttgagcaaattgaacgtagtcagcaacaatatgatgactggagc
tacctcaatcatttaatcggttccaaagaaggcgataaattccgcaagtttgcacaaggt
ctgacactcgatcatttagtctatctggcaaataaccaactcagtcggctgcatggccgc
taccaactgcagcgtaaaaccagtgatgcgctggagctgcaagtggtggacacctggcaa
gcagacgctatccgtgatacccgcacactgtcagggggagaaagcttcttagtcagttta
gccctagccttggcgctatcagatttggtcagccataaaaccagtattgactcgctattc
cttgatgaaggctttggcaccttggatgcagagacgctggatactgcactggatgccctt
gatagcctgaatgcctcaggtaaaaccattggggttatcagccatgtcgaagcaatgaaa
gaccgaattccagtgcaaattaaagttaagaaagtcaatggattgggggttagccgctta
gataatatcttccgagtcaatcaagactga

DBGET integrated database retrieval system