KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0278Help
Entry
YE0278            CDS       T00469                                 

Gene name
tufA
Definition
(RefSeq) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Brite
KEGG Orthology (KO) [BR:yen00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:yen03012]
    YE0278 (tufA)
   03029 Mitochondrial biogenesis [BR:yen03029]
    YE0278 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:yen04147]
    YE0278 (tufA)
Translation factors [BR:yen03012]
 Eukaryotic Type
  Elongation factors
   YE0278 (tufA)
 Prokaryotic Type
   YE0278 (tufA)
Mitochondrial biogenesis [BR:yen03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    YE0278 (tufA)
Exosome [BR:yen04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YE0278 (tufA)
  Exosomal proteins of breast cancer cells
   YE0278 (tufA)
  Exosomal proteins of colorectal cancer cells
   YE0278 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-GeneID: 4714390
NCBI-ProteinID: YP_001004661
UniProt: A1JIH3
LinkDB All DBs
Position
324617..325801
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRDLLSTYDFPGDDTPVVRGSALKALE
GEPEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGLKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREDIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIQMI
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaatgtgggtactatcggccac
gttgaccatggtaaaactaccctaactgctgcaatcaccaccgttctggctaaaacctac
ggcggaaatgctcgtgcattcgaccaaattgacaacgctcctgaagagaaggcgcgtggt
atcaccatcaacacgtctcatgttgaatatgacaccccgtcacgtcactatgcgcacgtt
gactgcccagggcacgccgactacgttaaaaacatgatcaccggtgctgctcagatggac
ggcgctatcctggttgttgctgcaactgatggcccaatgccacagactcgtgagcacatc
ctgttgggtcgtcaggttggtgttccttacatcatcgtattcatgaacaaatgtgacatg
gttgacgatgaagagctgctagaactggtagaaatggaagtgcgcgatcttctgtctacc
tacgatttcccaggcgatgatacgccagttgttcgtggttccgcgctgaaagcattggaa
ggcgaacctgagtgggaagcaaaaattatcgaactggctggctacctggattcttacatc
ccagaaccagagcgtgctatcgataagccgttcctgctgccaatcgaagacgtattctct
atctctggtcgtggtactgttgtaacgggtcgtgtagagcgcggtatcgttaaagttggt
gaagaagtcgaaattgttggcctgaaagataccgttaaatctacttgtactggcgttgaa
atgttccgcaaactgctggatgaaggccgtgcaggtgagaacgttggtgttctgctgcgt
ggtatcaagcgtgaagatatcgaacgtggtcaagttcttgctaaaccaggttcgattaaa
ccacacaccaaatttgaatcagaagtttatattctgagcaaagatgaaggtggtcgccat
actccgttcttcaaaggctaccgtcctcagttctacttccgtacaactgatgtaaccggt
actattgaactgccagaaggcgttgagatggtgatgccaggtgataacattcaaatgatt
gttaacctgattgctcctatcgcaatggatgacggcttgcgctttgcaattcgtgaaggc
ggtcgtactgtaggtgctggcgttgttgctaaagtcattgaataa

DBGET integrated database retrieval system