KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0674Help
Entry
YE0674            CDS       T00469                                 

Gene name
ddl
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00473  D-Alanine metabolism
yen00550  Peptidoglycan biosynthesis
yen01100  Metabolic pathways
yen01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    YE0674 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YE0674 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    YE0674 (ddl)
Enzymes [BR:yen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     YE0674 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:yen01011]
 Precursor biosynthesis
  Amino acid ligase
   YE0674 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATPgrasp_ST ATP-grasp_3 ATP-grasp RimK ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-GeneID: 4713459
NCBI-ProteinID: YP_001005023
UniProt: A1JJJ5
LinkDB All DBs
Position
779322..780242
Genome map
AA seq 306 aa AA seqDB search
MAEKVAVLLGGASAEREVSLLSGEAVLAGLREAGIDAHGIDTKDFPVTQLKEQGFDKVFI
ALHGRGGEDGTLQGVLEFLQLPYTGSGVMASALTMDKLRTKLVWQASGLPISPYIALNRQ
QFETLSSEELAACVAKLGLPLIVKPSHEGSSVGMSKVDQANQLHSALVEAFRHDTDVLIE
KWLSGPEFTVAILGNDVLPSIRIQAPGVFYDYEAKYLSDETQYFCPSGLSAELEQQLAAL
SLQAYQALGCSGWGRVDVMQDSDGRFYLLEVNTSPGMTSHSLVPMAARQHGLSFSQLVAR
ILTLAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaagttgcggtactgctgggtggggcctctgctgaacgtgaagtgtcattg
ttatcaggcgaggcggtattagcgggcttgagagaggctggtatcgatgctcatggtatt
gatactaaagacttcccggtgacacagcttaaagagcaaggctttgataaggtctttatc
gctttgcatgggcgcggtggtgaagacggcacgctgcaaggggtgttggagtttctgcaa
ttgccttataccggcagtggtgtgatggcttcagcgctgacaatggacaaattacgcacc
aaattggtatggcaagcttcaggtttgccaatttcaccgtatatcgcgttgaatcgtcaa
cagtttgaaacactttcgtcagaggaattggcggcgtgtgtcgctaagcttggcctgcca
ttaatcgttaagccaagtcatgaaggctctagcgtaggaatgagcaaggttgatcaggcg
aatcaattgcattctgctctggttgaagctttccgtcacgacactgatgtgctgattgag
aaatggttgagtgggccagagtttaccgtcgcgatccttggtaatgatgttttaccgtca
attcgcattcaggctcccggtgtgttttatgattatgaagctaaatatctgtctgatgaa
acccagtacttttgcccaagtggcttgagtgctgagttagaacaacagttggctgcattg
tcattacaggcctatcaggcattgggttgcagcggctggggccgagttgacgttatgcaa
gatagcgatggccgtttctacctgcttgaagtgaatacttcaccgggtatgaccagccac
agtttagtgccgatggctgcccgccaacatgggttgagtttttcccagttggtggcccga
attctgacgttggctgactaa

DBGET integrated database retrieval system