KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE0752Help
Entry
YE0752            CDS       T00469                                 

Gene name
sodC
Definition
(RefSeq) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
Brite
Enzymes [BR:yen01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YE0752 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 4716104
NCBI-ProteinID: YP_001005096
UniProt: A1JJR9
LinkDB All DBs
Position
877988..878512
Genome map
AA seq 174 aa AA seqDB search
MKLKYLVLPAMLFTSSVLAAEVTVTMNEALPEGNGKALGTVTVTETPYGLLFTPNLTGLV
AGIHGFHLHENPSCTPGQKDGKAVPALTAGGHFDPQKTAAHLGPYNDKGHLGDLPGLVVN
ADGTSTYQILAPRLKSLSELKQHALMIHAGGDNYADHPMPLGGGGARMACGVIE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaatacttagtgttacccgcaatgctttttaccagcagtgtgctggcagca
gaggttactgtgaccatgaatgaagcgctaccggaaggcaatggtaaagctttgggtacc
gtgacagtaaccgaaactccttatggtttattgttcacaccgaacctgactgggctggta
gcgggtattcatggtttccatctgcatgaaaatccaagttgtacaccggggcagaaagac
ggtaaagcggtgcccgcacttaccgctggcggccactttgacccacaaaaaaccgctgct
catctcgggccgtacaatgataaagggcatttaggcgacctacctgggctggtggtgaat
gccgatgggacttctacttatcagatattggctccacggctgaaatcactctctgaactg
aagcaacatgctttgatgatccatgctggtggggataattatgccgaccatccaatgcct
ctgggcggtggcggtgcacgaatggcttgtggtgtgattgagtaa

DBGET integrated database retrieval system