KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE1725Help
Entry
YE1725            CDS       T00469                                 

Gene name
icd
Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00020  Citrate cycle (TCA cycle)
yen00480  Glutathione metabolism
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01120  Microbial metabolism in diverse environments
yen01130  Biosynthesis of antibiotics
yen01200  Carbon metabolism
yen01210  2-Oxocarboxylic acid metabolism
yen01230  Biosynthesis of amino acids
Module
yen_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yen_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:yen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YE1725 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YE1725 (icd)
Enzymes [BR:yen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     YE1725 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-GeneID: 4712762
NCBI-ProteinID: YP_001006011
UniProt: A1JLN2
LinkDB All DBs
Position
1923886..1925139
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYNG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIREYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKDIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLMEGAKLLKCSEFGDAIIKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaagaaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgatcattccatttattgaaggtgacggcattggcgtt
gatgtgaccccagccatgatcaacgtggtggatgctgcggtgaagaaggcctataacggt
gagcgtaaaatctcctggatggaaatttacaccggtgagaaatcaactcatgtttatggc
aaagatgtctggctgccagaagaaacattggacttgattcgtgagtaccgcgttgcaatt
aaaggcccattgaccactccagtgggtggcggtattcgttctctgaacgttgctttgcgc
caacaacttgacttgtatgtgtgcctacgcccagtgcgttattacgaaggtaccccaagc
ccggtaaaacaccctgaattgaccaatatggtgattttccgcgaaaacgcagaagatatc
tatgcgggtatcgaatggaaagccggttcaccagaagctgaaaaagtgattaagttcctg
cgtgaagagatgggtgtgaagaaaattcgtttccctgaacaatgtggtattggtgtaaaa
ccgtgttcagaagaagggactaagcgtttggtacgtgctgcaattgagtatgcaattacc
aacgaccgtgaatcagtcaccctggttcataaaggcaacattatgaaattcaccgaaggc
gcatttaaagactggggttaccagttagcgcgtgaggaatttggtggtgagctgatcgat
ggcggcccttgggttaaaatcaagaatccaaacaacggtaaggacatcattgttaaagat
gtgattgccgatgctttcctgcaacagatcctgctgcgcccggctgaatatgatgttatc
gcgtgtatgaacctgaatggagattacatttctgatgcattggctgctcaagttggcggt
atcggtattgccccaggtgctaacattggtgatgagtgcgcattgtttgaagcgactcat
ggtacagcaccgaaatatgcgggtcaggataaagtgaacccaggttctattattctgtcc
gcagaaatgatgctgcgtcacatgggttggttcgaagccgcagacctgattatcaaaggc
accgaaggcgcaattcaggccaagacggtcacttatgatttcgaacgtctgatggaaggc
gctaagttactgaaatgcagtgaatttggcgacgccattattaagcacatgtaa

DBGET integrated database retrieval system