KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE2137Help
Entry
YE2137            CDS       T00469                                 

Gene name
gst
Definition
(RefSeq) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
Pathway
yen00480  Glutathione metabolism
yen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YE2137 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yen02000]
    YE2137 (gst)
Enzymes [BR:yen01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     YE2137 (gst)
Transporters [BR:yen02000]
 Other transporters
  Pores ion channels [TC:1]
   YE2137 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-GeneID: 4713537
NCBI-ProteinID: YP_001006377
UniProt: A1JNU4
LinkDB All DBs
Position
2338006..2338614
Genome map
AA seq 202 aa AA seqDB search
MKLFYKPGACSLSPHIVLREAGLDFSIESVDLATKKTETGEDYLHINPKGQVPALLLDDG
SLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFIATELHKGFSPLFNPKTPDE
YKAIARERLDKQFSYVDGVLAKHDYLLGSKFSVADAYLFTVTRWATALKLEIKQRSHLDK
YMARVAERPAVKAALAAEDVKK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttctataaacccggtgcctgctctttgtctccccacattgtattacgtgaa
gcggggctagacttcagtattgaaagtgtcgatttggcgactaaaaaaactgaaacgggt
gaagactatttgcacatcaacccgaaaggacaagtgcctgctctgctactggatgacgga
agcctactcactgaaggtgtggctatcgtgcaatatctggcggataaggtgcctgatcgc
cacctgattgcaccatcaggcaccctttcccgctaccacgccattgagtggttaaacttc
attgcgactgaattacataaaggtttcagcccgctgtttaacccgaaaacaccagacgaa
tataaagctattgcccgtgaacggctggataagcaatttagctatgtcgatggcgtatta
gcaaagcatgattatctgttaggctcaaaattcagcgtagccgatgcttatctatttacc
gtaacccgctgggcaactgcactgaaacttgaaattaaacagcgcagccatttagataaa
tatatggcgcgggtagcagagcgtccggcagtcaaagcggcgctggcagcagaagacgtg
aagaaataa

DBGET integrated database retrieval system