KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE3211Help
Entry
YE3211            CDS       T00469                                 

Gene name
ddlA
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00473  D-Alanine metabolism
yen00550  Peptidoglycan biosynthesis
yen01100  Metabolic pathways
yen01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:yen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    YE3211 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YE3211 (ddlA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    YE3211 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:yen01011]
    YE3211 (ddlA)
Enzymes [BR:yen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     YE3211 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:yen01011]
 Precursor biosynthesis
  Amino acid ligase
   YE3211 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-GeneID: 4715111
NCBI-ProteinID: YP_001007387
UniProt: A1JNY7
LinkDB All DBs
Position
complement(3496761..3497861)
Genome map
AA seq 366 aa AA seqDB search
MSKLRVGVIFGGKSAEHEVSLQSAKNIVDAIDKEKFDVTLLGIDKQGKWHVNDASNYLLN
AENPALISLNHSNKNVALIPGQEHQQLIATDSASALAQLDVIFPIVHGTLGEDGSLQGLL
RMANIPFVGSGVVGSAVSMDKDITKRLLRDAGLNIAPFITLTRANKDNYRFEQVTAKLGL
PLFIKPANQGSSVGVSKVRNAYEYEQAVALAFDFDHKVLVESAIVGREIECAVMGNDNPQ
ASLCGEVVISDEFYSYDTKYINETGAKVIIPASIDSAVSDNIRAVALAAFRALECRGMAR
VDVFLTADNTIIINEINTLPGFTNISMYPKLWRATGVGSTELITTLIELALERHQQDKSL
KNSIIK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaaattgcgagtgggtgtgatttttggcggtaaatcggctgaacatgaagtgtca
ttacagtcggccaagaacatcgtagatgcgattgataaagaaaaatttgatgtaacgctg
ttaggtattgataaacaaggtaaatggcatgttaatgatgcatctaattacttgttaaat
gcagaaaacccagcattgatttccctgaaccattcaaacaaaaatgtcgcgctgatccca
ggccaagagcatcagcagctgattgctaccgatagtgcctctgcattggctcagttggac
gtcattttcccgattgtccatgggacattaggggaggatggatccttgcaaggcctgcta
cgcatggcaaatattccttttgtcggctccggtgttgtgggttctgcggttagcatggat
aaagatatcaccaagcgtttattgcgtgatgctgggttgaatatcgcgccatttattacc
ctgacacgggcgaataaagataactatcgttttgagcaagttacggcaaaactcgggtta
cctttatttataaagccagcaaatcaaggctcctcggttggtgtgagtaaagtgcgtaat
gcatatgaatatgagcaggcggtagcattagcctttgattttgaccataaagtgttggtg
gagtcggctattgttgggcgagaaatcgaatgtgcagtgatgggcaatgataatccgcaa
gccagtttgtgtggtgaagtcgtcattagcgacgagttttattcctatgacacaaaatat
attaatgaaactggtgctaaggtcattatccctgcatcaatagacagtgccgtcagtgat
aatattcgggcagtcgctttagcggcttttcgcgcacttgagtgccgtggtatggctcgg
gtcgatgtctttttaacagctgataacactataattattaatgaaataaatacccttcct
ggatttaccaatattagtatgtatcctaaattgtggcgcgctacaggggttggctcgacg
gaattgatcaccacactgattgagctggctttagaacgtcatcagcaagataaatcgcta
aaaaattctattattaagtaa

DBGET integrated database retrieval system