KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE3693Help
Entry
YE3693            CDS       T00469                                 

Gene name
gadA
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00250  Alanine, aspartate and glutamate metabolism
yen00410  beta-Alanine metabolism
yen00430  Taurine and hypotaurine metabolism
yen00650  Butanoate metabolism
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01120  Microbial metabolism in diverse environments
yen02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:yen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    YE3693 (gadA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YE3693 (gadA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YE3693 (gadA)
   00430 Taurine and hypotaurine metabolism
    YE3693 (gadA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    YE3693 (gadA)
Enzymes [BR:yen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     YE3693 (gadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 4714092
NCBI-ProteinID: YP_001007848
UniProt: A1JR00
LinkDB All DBs
Position
complement(4032296..4033696)
Genome map
AA seq 466 aa AA seqDB search
MTRKSLDDYRSDLLDSRFGSKAIRNISENKVFPKEEMREDIAFQIISDELFLDGNARQNL
ATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDMRCVNMMADLWNAPTPKGAQGVG
TNTIGSSEACMLGGMAMKWRWRKKMEAAGKPTNKPNFVCGPVQVCWHKFARYWEVEIREI
PMIPGQLFMDPQRMIEACDENTIGVVPTFGVTYTGNYELPKPLHDALDKLQKDTGLDIDM
HIDAASGGFLAPFVAPDIEWDFRLPRVKSISTSGHKFGLAPLGCGWVIWRDAAALPEELI
FNVDYLGGQVGTFAINFSRPTGQVISQYYEFIRLGREGYTKVQSACYQVAEFLAKEIAPL
GPYEFYCSGGPYEGIPAICFRIKKGAKAGYTLYDLSERLRLRGWQVPAFTLSGKMSDVVV
MRIMCRRGFEMDFAGLLLDDFKSSLKYLSEHPSLGGEASQNSFSHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactagaaaatctctggatgattatcgctcagatttattagactctcgctttggctct
aaagcgattcgtaatatttcagaaaataaagtgttccctaaagaggagatgcgcgaggat
attgcttttcaaatcatcagtgatgagctatttcttgatggtaatgcgcgacaaaacctc
gccacattctgtcagacgtgggatgacgataatgtccacaaactgatggatctttcgata
aataaaaactggattgataaagaggaatatccgcaatcagcggcaatagatatgcgctgt
gtgaatatgatggctgatttgtggaatgcccctacaccaaagggcgcgcaaggggtaggg
accaataccattggttcgtcagaagcttgcatgctgggtggcatggcgatgaagtggcgc
tggcgcaaaaaaatggaagcggcaggtaaacccaccaataaacctaattttgtctgtggg
ccagtacaagtttgttggcataaatttgcccgttattgggaggtggaaattcgagaaatt
cctatgattccagggcaattatttatggacccgcagcgaatgatagaggcctgtgacgaa
aatactattggtgtagtgccgactttcggtgtgacttacaccggtaattatgaattaccc
aaacccttgcatgatgcgctggataaactgcaaaaagatactggccttgatattgatatg
catattgatgcggcgagtggtggctttttagctccctttgttgcgccggatattgagtgg
gacttccgcttgccacgggttaaatcaatcagcacttccgggcataaattcggactggct
cctttgggatgtggttgggttatttggcgtgatgctgccgctttacctgaagagctgata
tttaatgtcgattatcttggcgggcaggtcggcacatttgctatcaacttttcgcgtccg
acggggcaagttatttcccaatattatgaatttatacgcttagggcgtgaaggttatacc
aaagtgcaaagcgcctgctatcaggtagctgaattcctcgccaaagaaatagccccgctt
gggccttatgaattctattgcagcggtggcccatacgagggcattccagcgatttgtttc
cgcatcaaaaaaggagccaaggcggggtataccctatatgacctctccgagcgtttacga
ttgcgtggctggcaggttccggcatttacccttagtggcaagatgtcagatgtggtggtt
atgcgcatcatgtgccgccgcgggttcgagatggatttcgcagggctgctcttggatgat
tttaaatcctcactgaaatatctgagtgaacatccatcccttggaggcgaggcaagtcag
aatagttttagccatacataa

DBGET integrated database retrieval system