KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0116Help
Entry
YE105_C0116       CDS       T01480                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00620  Pyruvate metabolism
yep00680  Methane metabolism
yep01100  Metabolic pathways
yep01120  Microbial metabolism in diverse environments
yep01200  Carbon metabolism
Module
yep_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:yep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YE105_C0116
  09102 Energy metabolism
   00680 Methane metabolism
    YE105_C0116
Enzymes [BR:yep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     YE105_C0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADZ40614
LinkDB All DBs
Position
complement(137792..140431)
Genome map
AA seq 879 aa AA seqDB search
MNEQYSAMRSNVSMLGTLLGDTIKEALGEHILEKVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEALAQLFTRLKDKKLSEQD
MRSAVDELSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKIRPSPVDEAKWGFAVVENSLWEGVPAFLREFNEQLQNSLDYRLPVEAV
PIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRDIQVLVSELSMSECTPELRE
LAGGEEVLEPYRELMKRVRTQLTNTQAYLEARLKGERVLPPTDLLVSNDQLWDPLYACYQ
SLKACGMEIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDAIAELTRYLGLGDYESW
SEADKQAFLIRELNSKRPLVPLKWEPSADTQEVLETCRVIAEAPQGSIAAYVISMAKVPS
DVLAVHLLLKEAGCPFTLPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGISLTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYASAVLEANLLPPPEPKKEWNEVMDILS
DASCEMYRGYVRENPQFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQKAIDAGNKEVLATMCRDWPFFSTRIGMLEMVFAKADLWLAEY
YDQRLVDKSLWPLGQQLRDQLEADIKVVLAIANDDHLMADLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQENAADARVEQALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaacgtcagtatgctcggtacgctactcggg
gacaccatcaaggaagcacttggtgaacacatccttgaaaaagtagaaaccatccgtaaa
ttatctaaatcttcgcgtgccggtaatgaggcgagccgtcaggagctactgacgacactg
caaaatttatccaacgacgaactgctgccggtcgcccgtgcttttagccaattcctcaat
ctgacgaatacggcagagcaatatcacagcatttcgccgcatggtgaagccgcgagtaac
ccggaagctctggcccaactgttcacccgcttaaaagacaaaaagctgagtgagcaagac
atgcgcagcgcggttgatgagctatccattgagctggtgctaacggctcacccaacggaa
attacccgccgcaccttgattcataaactggttgaagtgaatacctgcctgagccagttg
gatcacaacgatttagccgattacgaacgcaacaagatcatgcgtcgtttgcggcagtta
gtcgcacaatcatggcatactgacgaaattcgtaaaatccgcccttccccggtcgatgaa
gctaaatggggctttgctgtggttgaaaacagcttatgggaaggtgtgcccgctttcctg
cgtgaatttaacgagcaattgcaaaactccctcgattatcgcttgccggtagaagcggtg
ccgatccgcttcacttcatggatgggtggcgaccgtgacggtaatccgaatgtcaccgct
gaaattacccgccatgtgctattactaagccgctggaaagcgaccgatttattcctgcgc
gacattcaggtattggtgtcagagctttctatgtcggaatgtacgccggaactgcgtgaa
ttggcgggcggcgaagaggtgctcgaaccttatcgtgaactgatgaaacgcgtgcgtact
cagttgaccaatactcaggcttatctggaagcacgtctgaaaggtgagcgcgtattgcca
ccaacagatttgctggtcagcaatgaccaattgtgggatccgctatacgcttgttatcaa
tccctgaaagcttgtggcatggaaatcatcgccaacggccagttactcgataccttacgc
cgcgtgcgctgttttggtgtgccattggtgcgtatcgatgtgcgtcaggaaagcacccgt
cataccgatgctattgctgaactgacccgctatctgggcctcggtgattatgaaagctgg
tctgaagcggacaaacaagccttcttgatccgcgaactgaactccaagcgcccactggtt
ccgctgaaatgggaacccagtgccgacacccaagaagtgttagaaacctgccgggtgatt
gccgaagcgccgcaaggttctatcgccgcttatgtgatttccatggcgaaagtgccatcg
gatgtgctggcggtgcatttactgctgaaagaagctggctgcccattcactctgccagtc
gcgccattgttcgaaacactcgatgacctgaacaatgcggacgacgtgatgacccagtta
ctgaatatcgactggtatcgcggcctgatccaaggcaagcagatggtgatgattggctat
tctgactcagcgaaagatgccggtgtaatggccgcgtcctgggcacaatatcgggcgcaa
gatgcgctaattaaaacctgcgagaaagccggtatctccctgacactgttccatggtcgc
ggcggttctatcggccgtggtggtgcacccgcccatgccgcgctactttctcagcctccg
ggcagcctgaaaggtggcttacgcgtgactgaacagggtgagatgatccgctttaagttt
ggtctgccggaagtcaccatcagcagtctggccctgtatgccagtgctgtactggaagcc
aatttgttaccgccgccggaaccgaagaaagagtggaatgaggtgatggatattctgtct
gatgcctcttgtgagatgtatcgcggctatgttcgtgaaaatccacagttcgttccttac
ttccgcgccgccacccctgaactggaattgggcaagctgccattgggttcgcgcccagcc
aaacgccgcccgaatggcggggtggaaagcctgcgtgctattccgtggatctttgcctgg
acacaaaaccgcctgatgttaccggcctggctgggggccggtgccggtttacagaaagcc
atcgatgccggtaataaagaagtattagccaccatgtgtcgtgactggccgttcttctca
acccgcattggtatgctggaaatggtgtttgccaaagccgatttgtggttggccgaatat
tatgaccagcgtctggtggataaatcattgtggccgttaggacagcaattacgcgaccaa
ctggaagccgatattaaagtggtgctggctatcgccaacgacgaccacttgatggcggat
ttaccgtggattgccgagtcgattgcactgcgtaacgtctataccgacccactaaacgtg
ttgcaagcggaactgttgcaccgctcgcgccagcaagaaaatgccgcagatgcccgtgtt
gagcaggcgttgatggtgactattgctggggtggcggcagggatgcgtaataccggttag

DBGET integrated database retrieval system