KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0281Help
Entry
YE105_C0281       CDS       T01480                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
Translation factors [BR:yep03012]
 Eukaryotic Type
  Elongation factors
   YE105_C0281
 Prokaryotic Type
   YE105_C0281
Mitochondrial biogenesis [BR:yep03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    YE105_C0281
Exosome [BR:yep04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YE105_C0281
  Exosomal proteins of breast cancer cells
   YE105_C0281
  Exosomal proteins of colorectal cancer cells
   YE105_C0281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ADZ40779
LinkDB All DBs
Position
343256..344440
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRDLLSTYDFPGDDTPVVRGSALKALE
GEPEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGLKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREDIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIQMI
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaatgtgggtactatcggccac
gttgaccatggtaaaactaccctaactgctgcaatcaccaccgttctggctaaaacctac
ggcggaaatgctcgtgcattcgaccaaattgacaacgctcctgaagagaaggcgcgtggt
atcaccatcaacacgtctcatgttgaatatgacaccccgtcacgtcactatgcgcacgtt
gactgcccagggcacgccgactacgttaaaaacatgatcaccggtgctgctcagatggat
ggcgctatcttggttgttgctgcaactgatggcccaatgccacagactcgtgagcacatc
ctgttgggtcgtcaggttggtgttccttacatcatcgtattcatgaacaaatgtgacatg
gttgacgatgaagagttgctggaactggtagaaatggaagtgcgcgatcttctgtctacc
tacgatttcccaggcgatgatacgccagttgttcgtggttcagcgctgaaagcattggaa
ggcgaacctgagtgggaagcaaaaattatcgaactggctggctacctggattcttacatc
ccagaaccagagcgtgctatcgataagccgttcctgctgccaatcgaagacgtattctct
atctctggccgtggtaccgttgtaacgggtcgtgtagagcgcggtattgttaaagttggc
gaagaagttgaaattgttggcctgaaagataccgttaaatctacttgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgcgggtgagaacgttggtgttctgctgcgt
ggtatcaagcgtgaagatatcgaacgtggtcaagttcttgctaaaccaggttctattaag
ccacacaccaaatttgaatcagaagtttatattctgagcaaagatgaaggtggccgccat
actccattctttaaaggctaccgtcctcagttctacttccgtacaactgatgtaaccggt
actattgaactgccagaaggcgttgagatggtgatgccaggcgataacattcaaatgatt
gttaacctgattgctcctatcgcaatggatgacggtttgcgcttcgcaattcgtgaaggc
ggtcgtactgtaggtgctggcgttgttgctaaagtcattgaataa

DBGET integrated database retrieval system