KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype O 9): YE105_C0758Help
Entry
YE105_C0758       CDS       T01480                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype:O:9)
Brite
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     YE105_C0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ADZ41254
LinkDB All DBs
Position
complement(896946..897494)
Genome map
AA seq 182 aa AA seqDB search
MKLKYLLLPAMLFTGSVLAAGVTVTMNEALPDGNGKALGTVTVTETPYGLLFTPNLTGLV
AGIHGFHLHENPSCAPGQKEGKAVPALAAGGHFDPQKTGTHLGPYSDKGHLGDLPGLVVN
ADGTATYQVLAPRLKSLSEVKQHALMIHAGGDNYADHPMPLGGAVREWLVVSLSNGLIQT
NW
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaatacctactgttaccggcgatgcttttcactggcagtgtgctggctgcc
ggggttaccgtgaccatgaatgaagcgctgccagacggaaatggcaaagcgctgggcact
gttaccgtgacagaaaccccttatggtttgctgttcacgccaaatctgactgggctggtt
gcgggtattcatggtttccacctccatgagaatccaagttgtgcgccggggcagaaagag
ggtaaagctgtgcccgcattggctgcgggtggccatttcgatccgcaaaaaaccgggaca
caccttgggccttatagtgataaagggcacttgggtgacttgccggggctggtggtcaat
gccgatggcactgctacctaccaagtattggctccgcgtctgaaatcgctatcagaggtg
aaacagcatgcgctaatgattcatgctggtggtgataactatgctgaccatcccatgcct
ttggggggggcggtgcgcgaatggcttgtggtgtcattgagtaacggcctgatacaaaca
aactggtag

DBGET integrated database retrieval system