KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype O 9): YE105_C2002Help
Entry
YE105_C2002       CDS       T01480                                 

Definition
(GenBank) undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase
  KO
K10012  undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase [EC:2.4.2.53]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype:O:9)
Pathway
yep00520  Amino sugar and nucleotide sugar metabolism
yep01100  Metabolic pathways
yep01503  Cationic antimicrobial peptide (CAMP) resistance
Module
yep_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:yep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YE105_C2002
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    YE105_C2002
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:yep01005]
    YE105_C2002
Enzymes [BR:yep01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.53  undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase
     YE105_C2002
Lipopolysaccharide biosynthesis proteins [BR:yep01005]
 Unusual sugar
  YE105_C2002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: ADZ42498
LinkDB All DBs
Position
2306765..2307682
Genome map
AA seq 305 aa AA seqDB search
MPILIERTSAACKLLTQPYEIILVDDGSSDNSAELLTAAANEPESHIIAVLLNRNYGQHS
AIMAGFNQVSGDLIITLDADLQNPPEEIPRLVSVAEEGYDVVGTVRAHRQDSVFRKTASR
MINMMIQRATGKSMGDYGCMLRAYRRHIVEAMLHCHERSTFIPILANTFARRTTEITVHH
AEREFGDSKYSLMKLINLMYDLITCLTTTPLRLLSLVGSVIALSGFTLAVLLVVLRLVFG
PEWAGGGVFTLFAVLFMFIGAQFVGMGLLGEYIGRIYNDVRARPRYFIQKVVGAEQTENN
QEVEK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgccgatattaatagagagaacgtcggctgcctgtaaattactgactcaaccctatgag
attattcttgttgatgatggtagcagtgataattcagctgaacttttaacagcagcggcg
aatgaaccggagagccatatcattgccgttttacttaatcgtaattatggccagcattca
gccattatggccggattcaatcaggtcagtggcgatttgatcattacactcgatgctgac
ttacaaaatccaccggaggagatccctcggttggtgagtgttgctgaagagggctatgac
gtggtgggtactgtgcgtgcgcatcgtcaagattcggtgttccgtaaaacagcttcccgc
atgatcaacatgatgatacaacgcgctacagggaaatcaatgggcgattacggctgtatg
ttacgggcctatcgccgccatattgttgaagcaatgttacattgccacgaacgcagtacc
tttattcctatcttggcaaatacatttgcccgtcgtacgaccgaaattaccgttcatcac
gcagaacgtgaatttggtgattcaaaatacagcctgatgaagctgatcaatctgatgtat
gacttgattacttgcctaacaacaacgccattacgtttattaagtctggttggcagtgtt
attgcgctctctggtttcactcttgccgtgttgttagtggttttacgcttggtatttggc
cctgaatgggcaggtggcggcgtctttacgctatttgccgtgttgtttatgttcattggt
gcccagtttgttggtatgggcctactcggtgaatatatcggtcgtatttataacgatgtg
cgcgcacgcccacgttatttcatacagaaagtggtcggcgctgagcagaccgaaaataat
caggaagtagaaaaatga

DBGET integrated database retrieval system