KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype O 9): YE105_C2256Help
Entry
YE105_C2256       CDS       T01480                                 

Definition
(GenBank) anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype:O:9)
Pathway
yep00400  Phenylalanine, tyrosine and tryptophan biosynthesis
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
yep01130  Biosynthesis of antibiotics
yep01230  Biosynthesis of amino acids
yep02024  Quorum sensing
Module
yep_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:yep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YE105_C2256
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    YE105_C2256
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    YE105_C2256
Enzymes [BR:yep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     YE105_C2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 B12-binding
Motif
Other DBs
NCBI-ProteinID: ADZ42752
LinkDB All DBs
Position
2591565..2592170
Genome map
AA seq 201 aa AA seqDB search
MENNLMADILLLDNIDSFTYNLVDQLRSSGHRVVIYRNQIAADTIIERLQQLEQPVLMLS
PGPGTPAQAGCMPELLQRLRGELPIIGICLGHQAIVEAYGGHVGQAGEILHGKASAIEHD
GHGMFAGMPNPLPVARYHSLVGSNIPTELTVNARFGEMVMAVRHDAHRVCGYQFHPESIL
TTQGARLLEQTLDWALSPSRV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataatctaatggccgatatcttgctgctcgataatatcgattcctttacctac
aacctggttgatcaactgcgttccagtggccatcgcgtagtgatataccgcaaccaaatt
gcggctgacaccattattgagcgtttgcaacaactcgaacaaccggtgttgatgctatca
cccggccctggtaccccagcgcaagctggctgtatgcctgagttgttacagcgtttacgc
ggcgagctaccgattatcggaatttgccttggccatcaagccattgtcgaagcctatggc
ggccatgttggtcaggctggtgaaatattgcatggtaaggcttctgccattgaacacgac
ggacacggcatgtttgccggaatgcctaatcctttaccggttgcccgctaccactcatta
gtcggcagcaatatccccacagaattaacggtaaacgcccgttttggcgagatggtcatg
gcggttcgtcatgatgcccatcgggtttgtggctaccaattccacccagaatcgatttta
accacccagggtgctcgcttgctggagcaaaccttagactgggcgctatccccttcgcgc
gtataa

DBGET integrated database retrieval system