KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2445Help
Entry
YE105_C2445       CDS       T01480                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00020  Citrate cycle (TCA cycle)
yep00480  Glutathione metabolism
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
yep01120  Microbial metabolism in diverse environments
yep01130  Biosynthesis of antibiotics
yep01200  Carbon metabolism
yep01210  2-Oxocarboxylic acid metabolism
yep01230  Biosynthesis of amino acids
Module
yep_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yep_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:yep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YE105_C2445
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YE105_C2445
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     YE105_C2445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: ADZ42941
LinkDB All DBs
Position
complement(2806600..2807853)
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYNG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIREYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKDIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLMEGAKLLKCSEFGDAIIKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaagaaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgatcattccatttattgaaggtgatggcattggcgtt
gatgtgaccccagccatgatcaacgtggtggatgctgcggttaagaaggcctataacggt
gagcgtaaaatctcctggatggaaatttacaccggtgagaaatcaactcatgtttatggc
aaagatgtctggctgccggaagaaacattggacttgattcgtgagtaccgcgttgcaatt
aaaggcccattgaccactccagtgggtggcggtattcgttctctgaacgttgctttgcgc
caacaactcgacttgtatgtgtgcctgcgcccagtgcgttattacgaaggtaccccaagc
ccggtaaaacaccctgaattgaccaatatggtgattttccgcgaaaacgcagaagatatc
tatgcgggtattgaatggaaagccggttcaccagaagctgaaaaagtgattaagtttctg
cgtgaagagatgggtgtgaagaaaattcgcttccctgaacaatgtggtattggtgtaaaa
ccatgttcagaagaagggactaagcgtttggtacgtgctgcaattgagtatgcaattacc
aacgatcgtgaatcagtcactctggttcataaaggcaacattatgaaattcaccgaaggt
gcatttaaagactggggttaccagttagcgcgtgaggaatttggtggtgagctgatcgat
ggcggcccttgggttaaaatcaagaatccaaacaacggtaaggatatcattgttaaagat
gtgattgccgatgctttcctgcaacagatcctgctgcgtccggctgaatatgatgttatc
gcgtgtatgaacctgaatggggattacatttctgatgcattggctgctcaagttggcggt
atcggtattgccccaggtgctaacattggtgatgagtgcgcattgtttgaagcgactcat
ggtacggcacctaaatatgcgggtcaggataaagtgaacccaggttctattattctgtcc
gcagaaatgatgctgcgtcacatgggctggttcgaagccgcagacctgattatcaaaggc
accgaaggtgcaattcaggccaagacggtcacttatgatttcgaacgtctgatggaaggc
gctaagttactgaaatgcagtgaatttggtgacgccattattaagcacatgtaa

DBGET integrated database retrieval system