KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype O 9): YE105_C2556
Entry
YE105_C2556       CDS       T01480                                 

Definition
(GenBank) 23S rRNA m(2)G2445 methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype:O:9)
Brite
KEGG Orthology (KO) [BR:yep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:yep03009]
    YE105_C2556
Enzymes [BR:yep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     YE105_C2556
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     YE105_C2556
Ribosome biogenesis [BR:yep03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    YE105_C2556
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_31 Methyltransf_25 Methyltransf_11 MTS Methyltransf_15 N6_Mtase Methyltransf_24
Other DBs
NCBI-ProteinID: ADZ43052
LinkDB
Position
complement(2935508..2937628)
AA seq 706 aa
MNSLFASTARGLEELLKSELEALGAHDCKIVQGGVHFQGDDRLMYQSLLWSRLASRILLP
LNDFKVYSDLDLYLGVQAIDWPSIFGVDKTFAVHFSGVNDEIRNSQYGALKVKDAIVDSF
TRKLDQRPTVAKQQPDIRVNVFLQREMASVALDLSGEGLHQRGYRDLTGQAPLKENLAAA
IIQRSGWQLGTPMVDPMCGSGTLLIEAAMMASDRAPGLHREHWGFTAWSAFNEELWRELT
TEAQVRARCGLQETTSRFFGSDIDRRVIEMARANARRAGVAELITFNANDVSKLVNPLPE
GPVGTVISNPPYGERLDSEPALIALHNMLGRIMKTSFGGWRLSLFSASPELLSCLQLRAE
REFKAKNGPLDCVQKNYQLAANPQGAAGVQVAEDYANRLRKNVKKLDKWAKQQGIECYRL
YDADLPDYNVAVDRYGSKVVVQEYAPPKTIDAQKARQRLFDVINATLAVLNLPSNQLVLK
TRERQKGKNQYEKLAQKGEFLLVSEYNAKLWVNLTDYLDTGLFLDHRIARQMLGKMSQGK
DFLNLFAYTGTASVHAGLGGARSTTTVDMSRTYLEWAEKNLRANGLTGQQHRLIQADCLS
WLSNTDEQFDVIFIDPPTFSNSKRMETTFDVQRDHLVLMKELKRLLRRKGTIMFSNNKRG
FQMDLDGIKALGLEAKEITAQTQSEDFARNRQIHNCWLVTHSHEEK
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgaactctctgtttgccagcacggcgcgtggactggaagaactgttaaaaagtgaactc
gaagcgttgggcgctcacgactgtaaaatagtgcagggcggggtacattttcagggcgac
gatcgactcatgtaccaaagcctgctgtggagccgtttggcttcgcgcattttgttaccg
ctcaatgattttaaagtttacagcgatttagatttgtaccttggggtgcaggcgattgat
tggccatcaatttttggtgtggataaaaccttcgccgtgcattttagcggcgtgaatgac
gaaatccgcaatagccagtatggggcattaaaagttaaagatgccatcgttgatagcttt
actcgtaagctggatcagcgcccaactgtagctaaacaacagccggatatccgggtgaat
gttttcctgcaacgagagatggccagtgtcgcgctggatctcagtggcgaaggtttgcat
cagcgcggctatcgtgaccttaccggtcaggcgccgctgaaagaaaatttggctgcggcg
attattcaacgttctggctggcagttgggcacaccgatggtcgatccgatgtgtggttca
ggtacattgctgattgaagctgccatgatggcatctgatcgcgcaccgggactgcatcgt
gagcattggggctttacagcctggagtgcttttaacgaagagctgtggcgtgaattaacc
accgaagcgcaagttcgtgcgcgctgtggtttgcaggagacgacctctcgcttctttggt
tctgatattgatcggcgggtgattgagatggctcgagccaatgcccgtcgcgctggggta
gcagaactgattacctttaatgccaatgatgtcagcaaattggtgaacccattaccggaa
gggccagtaggcacggttatcagtaacccaccttacggtgagcggttggacagtgaacca
gcattgattgcgttacataatatgctcggccgcatcatgaaaacgtcatttggtggctgg
cgtttatccctgttcagtgcctcgccggaactgctgagctgtctgcaattgcgtgcagag
cgcgaattcaaagccaagaatggcccgttggattgcgtgcagaaaaactatcaattagcg
gcaaatccgcaaggtgctgcgggtgttcaggttgcagaggattatgctaaccgcctgcgt
aagaatgtgaaaaagctggataaatgggctaagcaacagggcattgaatgttaccgcctg
tatgatgctgatttgccagattacaacgtggccgttgaccgttatggtagcaaggtggta
gtgcaggaatatgcgccaccgaagacgattgatgcacaaaaagcgcgtcagcgtctgttt
gatgtgattaatgccactttggcggtgttgaatttgccttctaaccagttggtattgaaa
actcgcgaacggcagaaaggcaaaaaccaatacgagaaattggctcagaaaggtgagttc
ctgctggtgagtgaatataatgccaagttatgggttaacctgactgattatctcgatacc
ggcctgttcctggaccaccgtattgcccgtcagatgctgggcaaaatgagccagggtaaa
gacttccttaacctattcgcttataccggtactgccagtgttcatgcagggctggggggc
gcgcgcagtactactacagttgatatgtcgcgcacctatttggaatgggcggagaaaaac
ctgcgagcaaatggtttaactggccagcagcaccgcttgattcaggccgattgcctctcc
tggctgagtaacaccgatgagcaattcgatgtgatcttcattgatccaccgacgttctcc
aactccaagcgtatggagaccacctttgatgttcaacgcgatcacttagtgctgatgaaa
gaacttaaacggttactgcgccgtaagggaacaatcatgttctcaaacaataagcgcggt
ttccagatggatttggacgggataaaggcgttgggattggaagcgaaagagatcactgcg
caaacacaatctgaagactttgcccgcaatcgtcaaatccacaactgttggctggtgact
cacagccacgaggaaaagtag

DBGET integrated database retrieval system