KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C3389Help
Entry
YE105_C3389       CDS       T01480                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00220  Arginine biosynthesis
yep00250  Alanine, aspartate and glutamate metabolism
yep00471  D-Glutamine and D-glutamate metabolism
yep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YE105_C3389
   00220 Arginine biosynthesis
    YE105_C3389
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    YE105_C3389
Enzymes [BR:yep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     YE105_C3389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ADZ43883
LinkDB All DBs
Position
complement(3906923..3907867)
Genome map
AA seq 314 aa AA seqDB search
MTIDRVRLNQVIKDAHSQYSTLAGGENASYIPYLASVSSKLAAVVVVTVDGDIISQGDAD
FRFALESISKVCSLALALEDIGPQAVQDKIGADPTGLPFNSVIALELHNGKPLSPLVNAG
AMSTVSVIKASSREDRWARILDIQQQLAGAPIALSDEVNHSEQTTNFHNRAIAWLLYSAQ
AMYCDPMEACDVYTRQCSTLFNTIELATMGATFAAGGKNPVTKKQVLTASNMPFILAEMT
MEGMYGSSGDWAYTVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDPVGNSVRGQKMVASV
AQQLGYNLYKGPLL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaccgcgttcgcctgaatcaagttattaaagatgcccattcacaatattcc
actctcgctggaggggagaatgccagctatattccgtatttggccagtgtttccagtaaa
ttagccgcagtggtggttgtcactgttgatggcgatattatttcacaaggtgatgccgat
tttcgctttgcattagagtctatttccaaagtctgctctcttgctttggcattagaagat
attggcccacaagccgtgcaagacaaaataggcgctgaccccaccggcttaccttttaat
tcggtgattgcattagaactgcataatggcaagccattgtcaccattagtcaatgcgggg
gcgatgtccaccgtgagtgtaattaaagccagcagtcgagaagatcgctgggcgcgtatt
ttggatattcagcagcaactggcgggtgcgccgattgcactttcggatgaagttaaccat
tcagagcaaaccaccaactttcataatcgggccattgcctggctgctttattcggcccaa
gccatgtattgcgatccgatggaagcctgtgacgtttatacccgccagtgctcaacatta
ttcaatactattgaattggcaactatgggagcaactttcgcggcgggtggcaaaaatcct
gtgaccaaaaaacaggtattaacagcttccaatatgccatttattttggctgaaatgacg
atggaaggaatgtacggcagctcaggtgattgggcttataccgtcgggttaccgggtaaa
agcggtgtcggcggcggaatattggcggttgtgccgggtgtcatggggattgctgcattc
tcaccgccgcttgacccagtgggtaatagtgttcgcggccagaaaatggtggcgtctgtg
gcgcagcagttgggatataacttatataaaggcccgcttttgtaa

DBGET integrated database retrieval system